BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0089.Seq (664 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 24 4.9 AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein p... 23 8.6 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 23.8 bits (49), Expect = 4.9 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = -1 Query: 151 ASYLIFTRLKS*DVNNQLRIGFQFNLLSLCFCSIK--YSVSFLSLITSTFQV 2 A +IF L VNN+ F LL++ FCS+ V LS + + F++ Sbjct: 536 AETIIFMFLGVATVNNKHVWNTWFVLLTIIFCSVYRILGVLILSALANRFRI 587 >AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein protein. Length = 400 Score = 23.0 bits (47), Expect = 8.6 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +3 Query: 363 AQNNRPHKIDGRIVEPKRAVPREEIKRPEA 452 AQ P G+ +PK+ + + +PEA Sbjct: 143 AQRETPKSSGGQSKQPKKKKKKRSLPKPEA 172 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 614,791 Number of Sequences: 2352 Number of extensions: 11811 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66068490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -