BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0088.Seq (745 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC064903-1|AAH64903.1| 304|Homo sapiens zinc finger protein 364... 58 3e-08 BC054049-1|AAH54049.1| 304|Homo sapiens zinc finger protein 364... 58 3e-08 AL390725-6|CAI13717.1| 304|Homo sapiens zinc finger protein 364... 58 3e-08 AL079314-1|CAB45280.1| 232|Homo sapiens hypothetical protein, s... 58 3e-08 AF542552-1|AAQ09535.1| 304|Homo sapiens zinc finger protein 364... 58 3e-08 AF419857-1|AAP97292.1| 304|Homo sapiens hypothetical protein pr... 58 3e-08 BC025374-1|AAH25374.1| 311|Homo sapiens ring finger protein 126... 53 1e-06 BC001442-1|AAH01442.1| 326|Homo sapiens ring finger protein 126... 53 1e-06 AL360265-1|CAB96178.1| 163|Homo sapiens AK000559 hypothetical p... 53 1e-06 AK000559-1|BAA91254.1| 311|Homo sapiens protein ( Homo sapiens ... 53 1e-06 AC004449-3|AAC06149.1| 103|Homo sapiens R33683_3 protein. 53 1e-06 BC114472-1|AAI14473.1| 345|Homo sapiens RNF130 protein protein. 52 2e-06 BC113864-1|AAI13865.1| 276|Homo sapiens RNF130 protein protein. 52 2e-06 BC108306-1|AAI08307.1| 419|Homo sapiens ring finger protein 130... 52 2e-06 BC065244-1|AAH65244.1| 306|Homo sapiens RNF130 protein protein. 52 2e-06 BC017100-1|AAH17100.2| 418|Homo sapiens RNF130 protein protein. 52 2e-06 AY083998-1|AAM08686.1| 419|Homo sapiens goliath protein protein. 52 2e-06 AF155650-1|AAF67007.1| 276|Homo sapiens goliath protein protein. 52 2e-06 AB209800-1|BAD93037.1| 401|Homo sapiens ring finger protein 130... 52 2e-06 BC101992-1|AAI01993.1| 314|Homo sapiens RNF150 protein protein. 52 2e-06 AK130520-1|BAC85369.1| 297|Homo sapiens protein ( Homo sapiens ... 52 2e-06 AB033040-1|BAA86528.1| 462|Homo sapiens KIAA1214 protein protein. 52 2e-06 BC030826-1|AAH30826.1| 708|Homo sapiens praja 2, RING-H2 motif ... 50 1e-05 AB007898-1|BAA23710.2| 726|Homo sapiens KIAA0438 protein. 50 1e-05 BC063404-1|AAH63404.1| 428|Homo sapiens ring finger protein 128... 49 2e-05 BC056677-1|AAH56677.1| 172|Homo sapiens RNF128 protein protein. 49 2e-05 BC030951-1|AAH30951.1| 215|Homo sapiens RNF128 protein protein. 49 2e-05 BC030530-1|AAH30530.1| 617|Homo sapiens synovial apoptosis inhi... 49 2e-05 AL606833-1|CAI41228.1| 402|Homo sapiens ring finger protein 128... 49 2e-05 AL391315-2|CAI39546.1| 402|Homo sapiens ring finger protein 128... 49 2e-05 AL391315-1|CAI39545.1| 428|Homo sapiens ring finger protein 128... 49 2e-05 AK126553-1|BAC86589.1| 402|Homo sapiens protein ( Homo sapiens ... 49 2e-05 AK074264-1|BAB85033.1| 428|Homo sapiens protein ( Homo sapiens ... 49 2e-05 AK074148-1|BAB84974.1| 298|Homo sapiens FLJ00221 protein protein. 49 2e-05 AK027169-1|BAB15682.1| 156|Homo sapiens protein ( Homo sapiens ... 49 2e-05 AF394689-1|AAK77554.1| 428|Homo sapiens GRAIL protein. 49 2e-05 AF317634-1|AAL26903.1| 616|Homo sapiens HRD1 protein. 49 2e-05 AB085847-1|BAC24801.1| 616|Homo sapiens HRD1 protein. 49 2e-05 AB058713-1|BAB47439.1| 579|Homo sapiens KIAA1810 protein protein. 49 2e-05 AB024690-1|BAC57449.1| 617|Homo sapiens Synoviolin1 protein. 49 2e-05 BC029264-1|AAH29264.1| 305|Homo sapiens ring finger protein 148... 49 2e-05 BC022038-1|AAH22038.1| 376|Homo sapiens ring finger protein 133... 49 2e-05 AK098524-1|BAC05321.1| 376|Homo sapiens protein ( Homo sapiens ... 49 2e-05 AF447589-1|AAM22872.1| 376|Homo sapiens unknown protein. 49 2e-05 AC006463-1|AAQ96858.1| 376|Homo sapiens unknown protein. 49 2e-05 AK222700-1|BAD96420.1| 153|Homo sapiens hypothetical protein LO... 48 3e-05 CR457165-1|CAG33446.1| 153|Homo sapiens LOC51255 protein. 48 5e-05 BC002803-1|AAH02803.1| 153|Homo sapiens hypothetical protein LO... 48 5e-05 AC016753-5|AAY24343.1| 153|Homo sapiens unknown protein. 48 5e-05 BC045743-1|AAH45743.1| 400|Homo sapiens ring finger protein 149... 47 6e-05 BC032328-1|AAH32328.2| 400|Homo sapiens ring finger protein 149... 47 6e-05 BC019355-1|AAH19355.2| 400|Homo sapiens ring finger protein 149... 47 6e-05 AY450390-1|AAR21083.1| 400|Homo sapiens DNA polymerase-transact... 47 6e-05 AK075141-1|BAC11430.1| 400|Homo sapiens protein ( Homo sapiens ... 47 6e-05 AK074985-1|BAC11334.1| 400|Homo sapiens protein ( Homo sapiens ... 47 6e-05 AC013722-2|AAY15089.1| 163|Homo sapiens unknown protein. 47 6e-05 AK098654-1|BAC05367.1| 305|Homo sapiens protein ( Homo sapiens ... 47 8e-05 BC148207-1|AAI48208.1| 395|Homo sapiens Unknown (protein for IM... 46 1e-04 BC069197-1|AAH69197.1| 643|Homo sapiens autocrine motility fact... 46 1e-04 BC017043-1|AAH17043.1| 292|Homo sapiens AMFR protein protein. 46 1e-04 AF124145-1|AAD56722.1| 643|Homo sapiens autocrine motility fact... 46 1e-04 BC063882-1|AAH63882.1| 1208|Homo sapiens zinc finger DAZ interac... 46 1e-04 AY495710-1|AAS75122.1| 275|Homo sapiens UURF2 ubiquitin ligase ... 46 1e-04 AY227652-1|AAO72968.1| 652|Homo sapiens RNA-binding RING-H2 pro... 46 1e-04 AB014575-1|BAA31650.2| 1217|Homo sapiens KIAA0675 protein protein. 46 1e-04 Z95113-1|CAI17901.1| 836|Homo sapiens protein ( Human DNA seque... 45 3e-04 CR456397-1|CAG30283.1| 836|Homo sapiens bK175E3.6 protein. 45 3e-04 BC109028-1|AAI09029.1| 783|Homo sapiens ring finger protein 43 ... 45 3e-04 BC094857-1|AAH94857.1| 643|Homo sapiens ZNRF3 protein protein. 45 3e-04 BC069019-1|AAH69019.1| 643|Homo sapiens ZNRF3 protein protein. 45 3e-04 BC021570-1|AAH21570.1| 653|Homo sapiens ZNRF3 protein protein. 45 3e-04 AL021393-4|CAI17992.1| 836|Homo sapiens protein ( Human DNA seq... 45 3e-04 AB051436-1|BAB33319.1| 891|Homo sapiens KIAA1133 protein protein. 45 3e-04 BC105053-1|AAI05054.1| 643|Homo sapiens praja 1 protein. 44 4e-04 BC105051-1|AAI05052.1| 643|Homo sapiens praja 1 protein. 44 4e-04 BC075803-1|AAH75803.1| 643|Homo sapiens praja 1 protein. 44 4e-04 BC048323-1|AAH48323.1| 384|Homo sapiens PJA1 protein protein. 44 4e-04 BC013357-1|AAH13357.1| 624|Homo sapiens ring finger protein 12 ... 44 4e-04 AL513007-2|CAI41712.1| 624|Homo sapiens ring finger protein 12 ... 44 4e-04 AL157699-3|CAI41605.1| 455|Homo sapiens praja 1 protein. 44 4e-04 AL157699-2|CAI41604.1| 643|Homo sapiens praja 1 protein. 44 4e-04 AL157699-1|CAM24741.1| 588|Homo sapiens praja 1 protein. 44 4e-04 AK021892-1|BAB13928.1| 361|Homo sapiens protein ( Homo sapiens ... 44 4e-04 AK001334-1|BAA91632.1| 624|Homo sapiens protein ( Homo sapiens ... 44 4e-04 AJ271670-1|CAC14228.1| 624|Homo sapiens RING zinc finger LIM do... 44 4e-04 AF264620-1|AAM53040.1| 455|Homo sapiens PRAJA1BETA protein. 44 4e-04 AF262024-1|AAM53039.1| 643|Homo sapiens PJA1 protein. 44 4e-04 AF155109-1|AAD42875.1| 483|Homo sapiens putative ring zinc fing... 44 4e-04 AK000322-1|BAA91085.1| 783|Homo sapiens protein ( Homo sapiens ... 44 6e-04 AB081837-1|BAD51435.1| 783|Homo sapiens urcc protein. 44 6e-04 BC063297-1|AAH63297.1| 432|Homo sapiens ring finger protein 44 ... 43 0.001 BC039833-1|AAH39833.1| 432|Homo sapiens ring finger protein 44 ... 43 0.001 BC033786-1|AAH33786.2| 465|Homo sapiens ring finger protein 38 ... 43 0.001 AL354935-3|CAO03541.1| 465|Homo sapiens ring finger protein 38 ... 43 0.001 AL354935-2|CAO03540.1| 515|Homo sapiens ring finger protein 38 ... 43 0.001 AL354935-1|CAH70194.1| 439|Homo sapiens ring finger protein 38 ... 43 0.001 AL161792-4|CAO03554.1| 465|Homo sapiens ring finger protein 38 ... 43 0.001 AL161792-3|CAO03553.1| 515|Homo sapiens ring finger protein 38 ... 43 0.001 AL161792-1|CAI16895.1| 439|Homo sapiens ring finger protein 38 ... 43 0.001 AK024996-1|BAB15050.1| 332|Homo sapiens protein ( Homo sapiens ... 43 0.001 AF394047-1|AAM73697.1| 432|Homo sapiens RING finger protein 38 ... 43 0.001 AB029023-1|BAA83052.2| 444|Homo sapiens KIAA1100 protein protein. 43 0.001 CR456804-1|CAG33085.1| 381|Homo sapiens RNF13 protein. 43 0.001 BC009803-1|AAH09803.1| 381|Homo sapiens ring finger protein 13 ... 43 0.001 BC009781-1|AAH09781.1| 381|Homo sapiens ring finger protein 13 ... 43 0.001 AF070558-1|AAC28641.1| 381|Homo sapiens RING zinc finger protei... 43 0.001 AF037204-1|AAC03769.1| 381|Homo sapiens RING zinc finger protei... 43 0.001 CR457340-1|CAG33621.1| 350|Homo sapiens DKFZP566H073 protein. 42 0.002 BC010139-1|AAH10139.1| 350|Homo sapiens ring finger protein 167... 42 0.002 AL834284-1|CAD38958.1| 349|Homo sapiens hypothetical protein pr... 42 0.002 AL050060-1|CAB43253.1| 324|Homo sapiens hypothetical protein pr... 42 0.002 AK025329-1|BAB15113.1| 350|Homo sapiens protein ( Homo sapiens ... 42 0.002 BC034688-1|AAH34688.1| 685|Homo sapiens ring finger protein (C3... 42 0.002 AY009109-1|AAG49400.1| 685|Homo sapiens ring-H2 protein protein. 42 0.002 AL138966-3|CAH73183.1| 685|Homo sapiens ring finger protein (C3... 42 0.002 AJ010347-1|CAB40414.1| 685|Homo sapiens RING-H2 protein. 42 0.002 AJ010346-1|CAB40413.1| 685|Homo sapiens RING-H2 protein. 42 0.002 AK127467-1|BAC86992.1| 346|Homo sapiens protein ( Homo sapiens ... 41 0.004 AK131304-1|BAD18471.1| 994|Homo sapiens protein ( Homo sapiens ... 40 0.007 BX538130-1|CAD98031.1| 986|Homo sapiens hypothetical protein pr... 40 0.009 BC101573-1|AAI01574.1| 155|Homo sapiens ring finger protein 122... 40 0.009 BC093884-1|AAH93884.1| 155|Homo sapiens ring finger protein 122... 40 0.009 BC060862-1|AAH60862.1| 985|Homo sapiens ring finger protein 111... 40 0.009 BC020984-1|AAH20984.1| 441|Homo sapiens RNF111 protein protein. 40 0.009 BC010369-1|AAH10369.1| 137|Homo sapiens RNF111 protein protein. 40 0.009 AK131488-1|BAD18633.1| 602|Homo sapiens protein ( Homo sapiens ... 40 0.009 AK095327-1|BAC04531.1| 370|Homo sapiens protein ( Homo sapiens ... 40 0.009 AK022588-1|BAB14115.1| 155|Homo sapiens protein ( Homo sapiens ... 40 0.009 BX537635-1|CAD97802.1| 120|Homo sapiens hypothetical protein pr... 40 0.012 BC042684-1|AAH42684.1| 663|Homo sapiens RNF145 protein protein. 40 0.012 AL831829-1|CAD38542.1| 121|Homo sapiens hypothetical protein pr... 40 0.012 AK098802-1|BAC05416.1| 268|Homo sapiens protein ( Homo sapiens ... 40 0.012 AK075101-1|BAC11401.1| 217|Homo sapiens protein ( Homo sapiens ... 40 0.012 AK056513-1|BAB71200.1| 691|Homo sapiens protein ( Homo sapiens ... 40 0.012 BC064636-1|AAH64636.1| 664|Homo sapiens ring finger protein 139... 39 0.022 BC021571-1|AAH21571.1| 664|Homo sapiens ring finger protein 139... 39 0.022 BC017878-1|AAH17878.1| 291|Homo sapiens RNF13 protein protein. 39 0.022 AF064801-1|AAC39930.1| 664|Homo sapiens multiple membrane spann... 39 0.022 BT007406-1|AAP36074.1| 148|Homo sapiens ring finger protein 24 ... 38 0.029 BC039584-1|AAH39584.1| 148|Homo sapiens RNF24 protein protein. 38 0.029 BC000213-1|AAH00213.1| 148|Homo sapiens RNF24 protein protein. 38 0.029 AL096778-1|CAB46627.1| 148|Homo sapiens hypothetical protein pr... 38 0.029 AL079313-1|CAB45279.1| 104|Homo sapiens hypothetical protein, s... 38 0.029 AL031670-4|CAB43182.1| 148|Homo sapiens ring finger protein 24 ... 38 0.029 D84296-1|BAA12303.1| 1715|Homo sapiens TPRDIII protein. 38 0.050 D84295-1|BAA12302.1| 1792|Homo sapiens possible protein TPRDII p... 38 0.050 D84294-1|BAA12301.1| 2025|Homo sapiens TPRDI protein. 38 0.050 D83327-1|BAA23666.1| 1941|Homo sapiens DCRR1 protein. 38 0.050 D83077-1|BAA11769.1| 2025|Homo sapiens TPRD protein. 38 0.050 BT007446-1|AAP36114.1| 485|Homo sapiens ring finger protein (C3... 38 0.050 BT007348-1|AAP36012.1| 113|Homo sapiens ring finger protein 7 p... 38 0.050 BC008627-1|AAH08627.1| 113|Homo sapiens ring finger protein 7 p... 38 0.050 BC007517-1|AAH07517.1| 485|Homo sapiens ring finger protein 8 p... 38 0.050 BC005966-1|AAH05966.1| 113|Homo sapiens ring finger protein 7 p... 38 0.050 AL096712-1|CAB75689.1| 485|Homo sapiens ring finger protein 8 p... 38 0.050 AK222765-1|BAD96485.1| 485|Homo sapiens ring finger protein 8 i... 38 0.050 AF334675-1|AAQ14887.1| 485|Homo sapiens UBC13/UEV-interacting r... 38 0.050 AF164679-1|AAD55984.1| 113|Homo sapiens ring finger protein CKB... 38 0.050 AF142060-1|AAD30147.1| 113|Homo sapiens RING finger protein pro... 38 0.050 AF092878-1|AAD25962.1| 113|Homo sapiens zinc RING finger protei... 38 0.050 AB014546-1|BAA31621.2| 486|Homo sapiens KIAA0646 protein protein. 38 0.050 AB012770-1|BAA33557.1| 485|Homo sapiens new zinc finger protein... 38 0.050 BT006662-1|AAP35308.1| 230|Homo sapiens C3HC4-like zinc finger ... 37 0.067 BC113014-1|AAI13015.1| 245|Homo sapiens ring finger protein 151... 37 0.067 BC029501-1|AAH29501.2| 244|Homo sapiens RNF151 protein protein. 37 0.067 BC018104-1|AAH18104.1| 230|Homo sapiens ring finger protein 141... 37 0.067 AF214680-1|AAF30180.1| 230|Homo sapiens C3HC4-like zinc finger ... 37 0.067 BC017592-1|AAH17592.2| 429|Homo sapiens zinc and ring finger 4 ... 37 0.088 AC005764-1|AAC62428.1| 420|Homo sapiens R31343_1 protein. 37 0.088 BC047654-1|AAH47654.1| 154|Homo sapiens ring finger protein 11 ... 36 0.15 BC020964-1|AAH20964.1| 154|Homo sapiens ring finger protein 11 ... 36 0.15 AL162430-11|CAI13140.1| 154|Homo sapiens ring finger protein 11... 36 0.15 AF151881-1|AAD34118.1| 154|Homo sapiens CGI-123 protein protein. 36 0.15 AB024703-1|BAA84683.1| 154|Homo sapiens Sid1669p protein. 36 0.15 CR542077-1|CAG46874.1| 326|Homo sapiens PEX10 protein. 36 0.20 BC088365-1|AAH88365.2| 435|Homo sapiens PTD016 protein protein. 36 0.20 BC018198-1|AAH18198.1| 326|Homo sapiens peroxisome biogenesis f... 36 0.20 BC000543-1|AAH00543.1| 346|Homo sapiens peroxisome biogenesis f... 36 0.20 AL513477-1|CAI22603.1| 346|Homo sapiens peroxisome biogenesis f... 36 0.20 AL445209-2|CAI15183.1| 726|Homo sapiens chromosome 13 open read... 36 0.20 AL139319-1|CAH70397.1| 726|Homo sapiens chromosome 13 open read... 36 0.20 AK098649-1|BAC05364.1| 252|Homo sapiens protein ( Homo sapiens ... 36 0.20 AF060502-1|AAC18133.1| 326|Homo sapiens peroxisome assembly pro... 36 0.20 AB013818-1|BAA87895.1| 326|Homo sapiens peroxisome biogenesis f... 36 0.20 AL079315-1|CAB45281.1| 158|Homo sapiens hypothetical protein pr... 35 0.27 CR456560-1|CAG30446.1| 108|Homo sapiens RBX1 protein. 35 0.35 BC017370-1|AAH17370.2| 115|Homo sapiens RBX1 protein protein. 35 0.35 BC001466-1|AAH01466.1| 108|Homo sapiens ring-box 1 protein. 35 0.35 AY099360-1|AAM21718.1| 95|Homo sapiens ZYP protein protein. 35 0.35 AL080242-1|CAB62925.1| 108|Homo sapiens ring-box 1 protein. 35 0.35 AF142059-1|AAD30146.1| 108|Homo sapiens RING finger protein pro... 35 0.35 AF140598-1|AAD29715.1| 108|Homo sapiens ring-box protein 1 prot... 35 0.35 BC104641-1|AAI04642.1| 84|Homo sapiens ANAPC11 protein protein. 34 0.47 BC095454-1|AAH95454.1| 84|Homo sapiens APC11 anaphase promotin... 34 0.47 BC066308-1|AAH66308.1| 84|Homo sapiens APC11 anaphase promotin... 34 0.47 AY332222-1|AAP93638.1| 592|Homo sapiens impedes mitogenic signa... 34 0.47 AF247789-1|AAL95694.1| 84|Homo sapiens putative anaphase-promo... 34 0.47 AF247565-1|AAF65816.1| 84|Homo sapiens anaphase promoting comp... 34 0.47 AF035620-1|AAC24200.1| 600|Homo sapiens BRCA1-associated protei... 34 0.47 AB208878-1|BAD92115.1| 632|Homo sapiens BRCA1 associated protei... 34 0.47 BC032637-1|AAH32637.1| 317|Homo sapiens ring finger protein 41 ... 33 0.82 AF077599-1|AAC27647.1| 317|Homo sapiens hypothetical SBBI03 pro... 33 0.82 D76444-1|BAA19739.1| 685|Homo sapiens hkf-1 protein. 33 1.1 BC110333-1|AAI10334.1| 685|Homo sapiens ring finger protein 103... 33 1.1 BC069226-1|AAH69226.1| 493|Homo sapiens tripartite motif-contai... 33 1.1 BC035053-1|AAH35053.1| 685|Homo sapiens ring finger protein 103... 33 1.1 BC018337-1|AAH18337.1| 206|Homo sapiens TRIM35 protein protein. 33 1.1 AF492463-1|AAO85480.1| 493|Homo sapiens hemopoeitic lineage swi... 33 1.1 AC015971-1|AAX93079.1| 685|Homo sapiens unknown protein. 33 1.1 AB052743-1|BAB20900.1| 685|Homo sapiens KF-1 protein protein. 33 1.1 AB029021-1|BAA83050.1| 504|Homo sapiens KIAA1098 protein protein. 33 1.1 CR533513-1|CAG38544.1| 362|Homo sapiens RNF32 protein. 33 1.4 BT007037-1|AAP35686.1| 235|Homo sapiens ring finger protein 32 ... 33 1.4 BC028120-1|AAH28120.1| 256|Homo sapiens RNF32 protein protein. 33 1.4 BC015416-1|AAH15416.1| 235|Homo sapiens RNF32 protein protein. 33 1.4 AF441222-1|AAM18664.1| 362|Homo sapiens ring finger protein RNF... 33 1.4 U95140-1|AAC52022.1| 190|Homo sapiens RNF4 protein. 32 1.9 BC107061-1|AAI07062.1| 242|Homo sapiens polycomb group ring fin... 32 1.9 BC031935-1|AAH31935.1| 190|Homo sapiens RNF4 protein protein. 32 1.9 BC012072-1|AAH12072.1| 652|Homo sapiens CHFR protein protein. 32 1.9 AK027687-1|BAB55297.1| 652|Homo sapiens protein ( Homo sapiens ... 32 1.9 AK001658-1|BAA91817.1| 623|Homo sapiens protein ( Homo sapiens ... 32 1.9 AJ001019-1|CAA04477.1| 247|Homo sapiens ring finger protein pro... 32 1.9 AF170724-1|AAF91084.1| 664|Homo sapiens cell cycle checkpoint p... 32 1.9 AB000468-1|BAA19122.1| 190|Homo sapiens zinc finger protein pro... 32 1.9 CR457298-1|CAG33579.1| 327|Homo sapiens RNF121 protein. 32 2.5 BC117273-1|AAI17274.1| 317|Homo sapiens RNF121 protein protein. 32 2.5 BC063680-1|AAH63680.1| 165|Homo sapiens RNF121 protein protein. 32 2.5 BC034385-1|AAH34385.1| 328|Homo sapiens ring finger protein 175... 32 2.5 BC009672-1|AAH09672.2| 329|Homo sapiens RNF121 protein protein. 32 2.5 BC004952-1|AAH04952.1| 247|Homo sapiens PCGF1 protein protein. 32 2.5 AK023139-1|BAB14423.1| 327|Homo sapiens 1,4-N-acetylglucosaminy... 32 2.5 AK001961-1|BAA92002.1| 152|Homo sapiens protein ( Homo sapiens ... 32 2.5 AF087884-1|AAP97183.1| 238|Homo sapiens RNF3A-2 protein. 32 2.5 BX248580-7|CAM25899.1| 488|Homo sapiens tripartite motif-contai... 31 4.4 BX248580-6|CAM25900.1| 518|Homo sapiens tripartite motif-contai... 31 4.4 BX248580-5|CAM25898.1| 261|Homo sapiens tripartite motif-contai... 31 4.4 BX248580-4|CAM25897.1| 144|Homo sapiens tripartite motif-contai... 31 4.4 BX248580-3|CAM25896.1| 74|Homo sapiens tripartite motif-contai... 31 4.4 BT007370-1|AAP36034.1| 488|Homo sapiens tripartite motif-contai... 31 4.4 BC150284-1|AAI50285.1| 1766|Homo sapiens ZNF294 protein protein. 31 4.4 BC034985-1|AAH34985.1| 488|Homo sapiens tripartite motif-contai... 31 4.4 BC007661-1|AAH07661.1| 488|Homo sapiens TRIM39 protein protein. 31 4.4 AL773535-7|CAI41818.1| 518|Homo sapiens tripartite motif-contai... 31 4.4 AL773535-6|CAI41819.1| 488|Homo sapiens tripartite motif-contai... 31 4.4 AL773535-5|CAM25728.1| 261|Homo sapiens tripartite motif-contai... 31 4.4 AL773535-4|CAM25727.1| 144|Homo sapiens tripartite motif-contai... 31 4.4 AL773535-3|CAM25726.1| 74|Homo sapiens tripartite motif-contai... 31 4.4 AL662832-13|CAI17502.1| 518|Homo sapiens tripartite motif-conta... 31 4.4 AL662832-12|CAI17501.1| 488|Homo sapiens tripartite motif-conta... 31 4.4 AL662832-11|CAO72127.1| 261|Homo sapiens tripartite motif-conta... 31 4.4 AL662832-10|CAO72126.1| 144|Homo sapiens tripartite motif-conta... 31 4.4 AL662832-9|CAO72125.1| 74|Homo sapiens tripartite motif-contai... 31 4.4 AL662795-7|CAI18252.1| 518|Homo sapiens tripartite motif-contai... 31 4.4 AL662795-6|CAI18251.1| 488|Homo sapiens tripartite motif-contai... 31 4.4 AL662795-5|CAM25557.1| 261|Homo sapiens tripartite motif-contai... 31 4.4 AL662795-4|CAM25556.1| 144|Homo sapiens tripartite motif-contai... 31 4.4 AL662795-3|CAM25555.1| 74|Homo sapiens tripartite motif-contai... 31 4.4 AL163248-2|CAB90429.3| 1574|Homo sapiens containing human KIAA07... 31 4.4 AB202089-1|BAE78608.1| 518|Homo sapiens tripartite motif-contai... 31 4.4 AB110938-1|BAD13704.1| 518|Homo sapiens TRIM39 protein protein. 31 4.4 AB110937-1|BAD13703.1| 518|Homo sapiens TRIM39 protein protein. 31 4.4 AB046381-1|BAB16374.1| 518|Homo sapiens testis-abundant finger ... 31 4.4 AB018257-1|BAA34434.2| 1780|Homo sapiens KIAA0714 protein protein. 31 4.4 BC059371-1|AAH59371.2| 774|Homo sapiens ring finger and WD repe... 31 5.8 BC047393-1|AAH47393.1| 261|Homo sapiens ring finger and CHY zin... 31 5.8 BC007235-1|AAH07235.1| 227|Homo sapiens ZNRF1 protein protein. 31 5.8 BC002574-1|AAH02574.2| 599|Homo sapiens RFWD3 protein protein. 31 5.8 AL834440-1|CAD39100.1| 271|Homo sapiens hypothetical protein pr... 31 5.8 AL136903-1|CAB66837.1| 227|Homo sapiens hypothetical protein pr... 31 5.8 AF378524-1|AAK69753.1| 227|Homo sapiens nin283 protein. 31 5.8 AF305424-1|AAL09356.1| 261|Homo sapiens zinc-finger protein pro... 31 5.8 AF255666-1|AAK96896.1| 261|Homo sapiens CHIMP protein. 31 5.8 AF247041-1|AAL76101.1| 261|Homo sapiens androgen receptor N-ter... 31 5.8 AB209072-1|BAD92309.1| 263|Homo sapiens RING finger and CHY zin... 31 5.8 BC114498-1|AAI14499.1| 347|Homo sapiens deltex 3 homolog (Droso... 30 7.6 BC114441-1|AAI14442.1| 347|Homo sapiens deltex 3 homolog (Droso... 30 7.6 BC019283-1|AAH19283.1| 469|Homo sapiens TRAF interacting protei... 30 7.6 BC014432-1|AAH14432.1| 360|Homo sapiens PDZRN3 protein protein. 30 7.6 BC000310-1|AAH00310.1| 469|Homo sapiens TRAF interacting protei... 30 7.6 AY225126-1|AAP57520.1| 347|Homo sapiens deltex 3 protein. 30 7.6 AK094385-1|BAC04344.1| 350|Homo sapiens protein ( Homo sapiens ... 30 7.6 AK092085-1|BAC03801.1| 347|Homo sapiens protein ( Homo sapiens ... 30 7.6 AF519623-1|AAM75350.1| 233|Homo sapiens RNA binding motif prote... 30 7.6 AB029018-1|BAA83047.1| 1098|Homo sapiens KIAA1095 protein protein. 30 7.6 >BC064903-1|AAH64903.1| 304|Homo sapiens zinc finger protein 364 protein. Length = 304 Score = 58.4 bits (135), Expect = 3e-08 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSL 87 L C H FHSSCI PWL+LH TCP+CR+SL Sbjct: 244 LPCNHFFHSSCIVPWLELHDTCPVCRKSL 272 >BC054049-1|AAH54049.1| 304|Homo sapiens zinc finger protein 364 protein. Length = 304 Score = 58.4 bits (135), Expect = 3e-08 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSL 87 L C H FHSSCI PWL+LH TCP+CR+SL Sbjct: 244 LPCNHFFHSSCIVPWLELHDTCPVCRKSL 272 >AL390725-6|CAI13717.1| 304|Homo sapiens zinc finger protein 364 protein. Length = 304 Score = 58.4 bits (135), Expect = 3e-08 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSL 87 L C H FHSSCI PWL+LH TCP+CR+SL Sbjct: 244 LPCNHFFHSSCIVPWLELHDTCPVCRKSL 272 >AL079314-1|CAB45280.1| 232|Homo sapiens hypothetical protein, similar to (U06944) PRAJA1 [Mus musculus] protein. Length = 232 Score = 58.4 bits (135), Expect = 3e-08 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSL 87 L C H FHSSCI PWL+LH TCP+CR+SL Sbjct: 172 LPCNHFFHSSCIVPWLELHDTCPVCRKSL 200 >AF542552-1|AAQ09535.1| 304|Homo sapiens zinc finger protein 364 protein. Length = 304 Score = 58.4 bits (135), Expect = 3e-08 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSL 87 L C H FHSSCI PWL+LH TCP+CR+SL Sbjct: 244 LPCNHFFHSSCIVPWLELHDTCPVCRKSL 272 >AF419857-1|AAP97292.1| 304|Homo sapiens hypothetical protein protein. Length = 304 Score = 58.4 bits (135), Expect = 3e-08 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSL 87 L C H FHSSCI PWL+LH TCP+CR+SL Sbjct: 244 LPCNHFFHSSCIVPWLELHDTCPVCRKSL 272 >BC025374-1|AAH25374.1| 311|Homo sapiens ring finger protein 126 protein. Length = 311 Score = 52.8 bits (121), Expect = 1e-06 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSL 87 L C HLFH CI PWL+ H +CP+CR+SL Sbjct: 245 LPCNHLFHDGCIVPWLEQHDSCPVCRKSL 273 >BC001442-1|AAH01442.1| 326|Homo sapiens ring finger protein 126 protein. Length = 326 Score = 52.8 bits (121), Expect = 1e-06 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSL 87 L C HLFH CI PWL+ H +CP+CR+SL Sbjct: 245 LPCNHLFHDGCIVPWLEQHDSCPVCRKSL 273 >AL360265-1|CAB96178.1| 163|Homo sapiens AK000559 hypothetical protein, similar to (U06944) PRAJA1 [Mus musculus] protein. Length = 163 Score = 52.8 bits (121), Expect = 1e-06 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSL 87 L C HLFH CI PWL+ H +CP+CR+SL Sbjct: 97 LPCNHLFHDGCIVPWLEQHDSCPVCRKSL 125 >AK000559-1|BAA91254.1| 311|Homo sapiens protein ( Homo sapiens cDNA FLJ20552 fis, clone KAT11732. ). Length = 311 Score = 52.8 bits (121), Expect = 1e-06 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSL 87 L C HLFH CI PWL+ H +CP+CR+SL Sbjct: 245 LPCNHLFHDGCIVPWLEQHDSCPVCRKSL 273 >AC004449-3|AAC06149.1| 103|Homo sapiens R33683_3 protein. Length = 103 Score = 52.8 bits (121), Expect = 1e-06 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSL 87 L C HLFH CI PWL+ H +CP+CR+SL Sbjct: 37 LPCNHLFHDGCIVPWLEQHDSCPVCRKSL 65 >BC114472-1|AAI14473.1| 345|Homo sapiens RNF130 protein protein. Length = 345 Score = 52.4 bits (120), Expect = 2e-06 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C+H+FH SC+ PWL H TCP+C+ ++L A Sbjct: 206 LPCKHVFHKSCVDPWLSEHCTCPMCKLNILKA 237 >BC113864-1|AAI13865.1| 276|Homo sapiens RNF130 protein protein. Length = 276 Score = 52.4 bits (120), Expect = 2e-06 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C+H+FH SC+ PWL H TCP+C+ ++L A Sbjct: 137 LPCKHVFHKSCVDPWLSEHCTCPMCKLNILKA 168 >BC108306-1|AAI08307.1| 419|Homo sapiens ring finger protein 130 protein. Length = 419 Score = 52.4 bits (120), Expect = 2e-06 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C+H+FH SC+ PWL H TCP+C+ ++L A Sbjct: 280 LPCKHVFHKSCVDPWLSEHCTCPMCKLNILKA 311 >BC065244-1|AAH65244.1| 306|Homo sapiens RNF130 protein protein. Length = 306 Score = 52.4 bits (120), Expect = 2e-06 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C+H+FH SC+ PWL H TCP+C+ ++L A Sbjct: 167 LPCKHVFHKSCVDPWLSEHCTCPMCKLNILKA 198 >BC017100-1|AAH17100.2| 418|Homo sapiens RNF130 protein protein. Length = 418 Score = 52.4 bits (120), Expect = 2e-06 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C+H+FH SC+ PWL H TCP+C+ ++L A Sbjct: 279 LPCKHVFHKSCVDPWLSEHCTCPMCKLNILKA 310 >AY083998-1|AAM08686.1| 419|Homo sapiens goliath protein protein. Length = 419 Score = 52.4 bits (120), Expect = 2e-06 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C+H+FH SC+ PWL H TCP+C+ ++L A Sbjct: 280 LPCKHVFHKSCVDPWLSEHCTCPMCKLNILKA 311 >AF155650-1|AAF67007.1| 276|Homo sapiens goliath protein protein. Length = 276 Score = 52.4 bits (120), Expect = 2e-06 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C+H+FH SC+ PWL H TCP+C+ ++L A Sbjct: 137 LPCKHVFHKSCVDPWLSEHCTCPMCKLNILKA 168 >AB209800-1|BAD93037.1| 401|Homo sapiens ring finger protein 130 variant protein. Length = 401 Score = 52.4 bits (120), Expect = 2e-06 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C+H+FH SC+ PWL H TCP+C+ ++L A Sbjct: 297 LPCKHVFHKSCVDPWLSEHCTCPMCKLNILKA 328 >BC101992-1|AAI01993.1| 314|Homo sapiens RNF150 protein protein. Length = 314 Score = 52.0 bits (119), Expect = 2e-06 Identities = 18/32 (56%), Positives = 23/32 (71%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C HLFH SC+ PWL H TCP+C+ ++L A Sbjct: 203 LPCRHLFHKSCVDPWLLDHRTCPMCKMNILKA 234 >AK130520-1|BAC85369.1| 297|Homo sapiens protein ( Homo sapiens cDNA FLJ27010 fis, clone SLV05175. ). Length = 297 Score = 52.0 bits (119), Expect = 2e-06 Identities = 18/32 (56%), Positives = 23/32 (71%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C HLFH SC+ PWL H TCP+C+ ++L A Sbjct: 153 LPCRHLFHKSCVDPWLLDHRTCPMCKMNILKA 184 >AB033040-1|BAA86528.1| 462|Homo sapiens KIAA1214 protein protein. Length = 462 Score = 52.0 bits (119), Expect = 2e-06 Identities = 18/32 (56%), Positives = 23/32 (71%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C HLFH SC+ PWL H TCP+C+ ++L A Sbjct: 318 LPCRHLFHKSCVDPWLLDHRTCPMCKMNILKA 349 >BC030826-1|AAH30826.1| 708|Homo sapiens praja 2, RING-H2 motif containing protein. Length = 708 Score = 49.6 bits (113), Expect = 1e-05 Identities = 18/32 (56%), Positives = 20/32 (62%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C H FH C+S WLQ TCP+CRR PA Sbjct: 650 LPCHHFFHKPCVSIWLQKSGTCPVCRRHFPPA 681 >AB007898-1|BAA23710.2| 726|Homo sapiens KIAA0438 protein. Length = 726 Score = 49.6 bits (113), Expect = 1e-05 Identities = 18/32 (56%), Positives = 20/32 (62%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C H FH C+S WLQ TCP+CRR PA Sbjct: 668 LPCHHFFHKPCVSIWLQKSGTCPVCRRHFPPA 699 >BC063404-1|AAH63404.1| 428|Homo sapiens ring finger protein 128 protein. Length = 428 Score = 49.2 bits (112), Expect = 2e-05 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C H+FH +C+ PWL H TCP+C+ +L A Sbjct: 293 LTCNHIFHKTCVDPWLLEHRTCPMCKCDILKA 324 >BC056677-1|AAH56677.1| 172|Homo sapiens RNF128 protein protein. Length = 172 Score = 49.2 bits (112), Expect = 2e-05 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C H+FH +C+ PWL H TCP+C+ +L A Sbjct: 37 LTCNHIFHKTCVDPWLLEHRTCPMCKCDILKA 68 >BC030951-1|AAH30951.1| 215|Homo sapiens RNF128 protein protein. Length = 215 Score = 49.2 bits (112), Expect = 2e-05 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C H+FH +C+ PWL H TCP+C+ +L A Sbjct: 80 LTCNHIFHKTCVDPWLLEHRTCPMCKCDILKA 111 >BC030530-1|AAH30530.1| 617|Homo sapiens synovial apoptosis inhibitor 1, synoviolin protein. Length = 617 Score = 49.2 bits (112), Expect = 2e-05 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 4/40 (10%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR----RSLLPADPPP 108 L C H+FH+SC+ W Q TCP CR R+ LPA PP Sbjct: 305 LPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLPAQSPP 344 >AL606833-1|CAI41228.1| 402|Homo sapiens ring finger protein 128 protein. Length = 402 Score = 49.2 bits (112), Expect = 2e-05 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C H+FH +C+ PWL H TCP+C+ +L A Sbjct: 267 LTCNHIFHKTCVDPWLLEHRTCPMCKCDILKA 298 >AL391315-2|CAI39546.1| 402|Homo sapiens ring finger protein 128 protein. Length = 402 Score = 49.2 bits (112), Expect = 2e-05 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C H+FH +C+ PWL H TCP+C+ +L A Sbjct: 267 LTCNHIFHKTCVDPWLLEHRTCPMCKCDILKA 298 >AL391315-1|CAI39545.1| 428|Homo sapiens ring finger protein 128 protein. Length = 428 Score = 49.2 bits (112), Expect = 2e-05 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C H+FH +C+ PWL H TCP+C+ +L A Sbjct: 293 LTCNHIFHKTCVDPWLLEHRTCPMCKCDILKA 324 >AK126553-1|BAC86589.1| 402|Homo sapiens protein ( Homo sapiens cDNA FLJ44589 fis, clone BEAST2000981, weakly similar to Mus musculus ring finger protein 130 (Rnf130). ). Length = 402 Score = 49.2 bits (112), Expect = 2e-05 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C H+FH +C+ PWL H TCP+C+ +L A Sbjct: 267 LTCNHIFHKTCVDPWLLEHRTCPMCKCDILKA 298 >AK074264-1|BAB85033.1| 428|Homo sapiens protein ( Homo sapiens cDNA FLJ23684 fis, clone HEP09821. ). Length = 428 Score = 49.2 bits (112), Expect = 2e-05 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C H+FH +C+ PWL H TCP+C+ +L A Sbjct: 293 LTCNHIFHKTCVDPWLLEHRTCPMCKCDILKA 324 >AK074148-1|BAB84974.1| 298|Homo sapiens FLJ00221 protein protein. Length = 298 Score = 49.2 bits (112), Expect = 2e-05 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 4/40 (10%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR----RSLLPADPPP 108 L C H+FH+SC+ W Q TCP CR R+ LPA PP Sbjct: 174 LPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLPAQSPP 213 >AK027169-1|BAB15682.1| 156|Homo sapiens protein ( Homo sapiens cDNA: FLJ23516 fis, clone LNG04848. ). Length = 156 Score = 49.2 bits (112), Expect = 2e-05 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C H+FH +C+ PWL H TCP+C+ +L A Sbjct: 21 LTCNHIFHKTCVDPWLLEHRTCPMCKCDILKA 52 >AF394689-1|AAK77554.1| 428|Homo sapiens GRAIL protein. Length = 428 Score = 49.2 bits (112), Expect = 2e-05 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C H+FH +C+ PWL H TCP+C+ +L A Sbjct: 293 LTCNHIFHKTCVDPWLLEHRTCPMCKCDILKA 324 >AF317634-1|AAL26903.1| 616|Homo sapiens HRD1 protein. Length = 616 Score = 49.2 bits (112), Expect = 2e-05 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 4/40 (10%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR----RSLLPADPPP 108 L C H+FH+SC+ W Q TCP CR R+ LPA PP Sbjct: 305 LPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLPAQSPP 344 >AB085847-1|BAC24801.1| 616|Homo sapiens HRD1 protein. Length = 616 Score = 49.2 bits (112), Expect = 2e-05 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 4/40 (10%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR----RSLLPADPPP 108 L C H+FH+SC+ W Q TCP CR R+ LPA PP Sbjct: 305 LPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLPAQSPP 344 >AB058713-1|BAB47439.1| 579|Homo sapiens KIAA1810 protein protein. Length = 579 Score = 49.2 bits (112), Expect = 2e-05 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 4/40 (10%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR----RSLLPADPPP 108 L C H+FH+SC+ W Q TCP CR R+ LPA PP Sbjct: 268 LPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLPAQSPP 307 >AB024690-1|BAC57449.1| 617|Homo sapiens Synoviolin1 protein. Length = 617 Score = 49.2 bits (112), Expect = 2e-05 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 4/40 (10%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR----RSLLPADPPP 108 L C H+FH+SC+ W Q TCP CR R+ LPA PP Sbjct: 305 LPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLPAQSPP 344 >BC029264-1|AAH29264.1| 305|Homo sapiens ring finger protein 148 protein. Length = 305 Score = 48.8 bits (111), Expect = 2e-05 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLL 90 L C+H FH +CI PWL H TCP+C+ +L Sbjct: 274 LTCKHFFHKACIDPWLLAHRTCPMCKCDIL 303 >BC022038-1|AAH22038.1| 376|Homo sapiens ring finger protein 133 protein. Length = 376 Score = 48.8 bits (111), Expect = 2e-05 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLL 90 L C+H FH +CI PW+ H TCPIC+ +L Sbjct: 272 LTCKHFFHKNCIDPWILPHGTCPICKCDIL 301 >AK098524-1|BAC05321.1| 376|Homo sapiens protein ( Homo sapiens cDNA FLJ25658 fis, clone TST00370. ). Length = 376 Score = 48.8 bits (111), Expect = 2e-05 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLL 90 L C+H FH +CI PW+ H TCPIC+ +L Sbjct: 272 LTCKHFFHKNCIDPWILPHGTCPICKCDIL 301 >AF447589-1|AAM22872.1| 376|Homo sapiens unknown protein. Length = 376 Score = 48.8 bits (111), Expect = 2e-05 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLL 90 L C+H FH +CI PW+ H TCPIC+ +L Sbjct: 272 LTCKHFFHKNCIDPWILPHGTCPICKCDIL 301 >AC006463-1|AAQ96858.1| 376|Homo sapiens unknown protein. Length = 376 Score = 48.8 bits (111), Expect = 2e-05 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLL 90 L C+H FH +CI PW+ H TCPIC+ +L Sbjct: 272 LTCKHFFHKNCIDPWILPHGTCPICKCDIL 301 >AK222700-1|BAD96420.1| 153|Homo sapiens hypothetical protein LOC51255 variant protein. Length = 153 Score = 48.4 bits (110), Expect = 3e-05 Identities = 19/33 (57%), Positives = 22/33 (66%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPAD 99 + C HLFHSSCI PWL +CP+CR LP D Sbjct: 92 MPCHHLFHSSCILPWLSKTNSCPLCRHE-LPTD 123 >CR457165-1|CAG33446.1| 153|Homo sapiens LOC51255 protein. Length = 153 Score = 47.6 bits (108), Expect = 5e-05 Identities = 19/33 (57%), Positives = 22/33 (66%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPAD 99 + C HLFHSSCI PWL +CP+CR LP D Sbjct: 92 MPCHHLFHSSCILPWLSKTNSCPLCRYE-LPTD 123 >BC002803-1|AAH02803.1| 153|Homo sapiens hypothetical protein LOC51255 protein. Length = 153 Score = 47.6 bits (108), Expect = 5e-05 Identities = 19/33 (57%), Positives = 22/33 (66%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPAD 99 + C HLFHSSCI PWL +CP+CR LP D Sbjct: 92 MPCHHLFHSSCILPWLSKTNSCPLCRYE-LPTD 123 >AC016753-5|AAY24343.1| 153|Homo sapiens unknown protein. Length = 153 Score = 47.6 bits (108), Expect = 5e-05 Identities = 19/33 (57%), Positives = 22/33 (66%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPAD 99 + C HLFHSSCI PWL +CP+CR LP D Sbjct: 92 MPCHHLFHSSCILPWLSKTNSCPLCRYE-LPTD 123 >BC045743-1|AAH45743.1| 400|Homo sapiens ring finger protein 149 protein. Length = 400 Score = 47.2 bits (107), Expect = 6e-05 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C+H+FH CI PWL H TCP+C+ ++ A Sbjct: 285 LPCKHIFHRICIDPWLLDHRTCPMCKLDVIKA 316 >BC032328-1|AAH32328.2| 400|Homo sapiens ring finger protein 149 protein. Length = 400 Score = 47.2 bits (107), Expect = 6e-05 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C+H+FH CI PWL H TCP+C+ ++ A Sbjct: 285 LPCKHIFHRICIDPWLLDHRTCPMCKLDVIKA 316 >BC019355-1|AAH19355.2| 400|Homo sapiens ring finger protein 149 protein. Length = 400 Score = 47.2 bits (107), Expect = 6e-05 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C+H+FH CI PWL H TCP+C+ ++ A Sbjct: 285 LPCKHIFHRICIDPWLLDHRTCPMCKLDVIKA 316 >AY450390-1|AAR21083.1| 400|Homo sapiens DNA polymerase-transactivated protein 2 protein. Length = 400 Score = 47.2 bits (107), Expect = 6e-05 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C+H+FH CI PWL H TCP+C+ ++ A Sbjct: 285 LPCKHIFHRICIDPWLLDHRTCPMCKLDVIKA 316 >AK075141-1|BAC11430.1| 400|Homo sapiens protein ( Homo sapiens cDNA FLJ90660 fis, clone PLACE1004887, weakly similar to GOLIATH PROTEIN. ). Length = 400 Score = 47.2 bits (107), Expect = 6e-05 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C+H+FH CI PWL H TCP+C+ ++ A Sbjct: 285 LPCKHIFHRICIDPWLLDHRTCPMCKLDVIKA 316 >AK074985-1|BAC11334.1| 400|Homo sapiens protein ( Homo sapiens cDNA FLJ90504 fis, clone NT2RP3004090, weakly similar to GOLIATH PROTEIN. ). Length = 400 Score = 47.2 bits (107), Expect = 6e-05 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C+H+FH CI PWL H TCP+C+ ++ A Sbjct: 285 LPCKHIFHRICIDPWLLDHRTCPMCKLDVIKA 316 >AC013722-2|AAY15089.1| 163|Homo sapiens unknown protein. Length = 163 Score = 47.2 bits (107), Expect = 6e-05 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPA 96 L C+H+FH CI PWL H TCP+C+ ++ A Sbjct: 48 LPCKHIFHRICIDPWLLDHRTCPMCKLDVIKA 79 >AK098654-1|BAC05367.1| 305|Homo sapiens protein ( Homo sapiens cDNA FLJ25788 fis, clone TST06884. ). Length = 305 Score = 46.8 bits (106), Expect = 8e-05 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLL 90 L C+H FH +CI PWL H CP+C+ +L Sbjct: 274 LTCKHFFHKACIDPWLLAHRACPMCKCDIL 303 >BC148207-1|AAI48208.1| 395|Homo sapiens Unknown (protein for IMAGE:40112974) protein. Length = 395 Score = 46.4 bits (105), Expect = 1e-04 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPAD 99 L C HLFH+SC+ WL+ +CP CR SL AD Sbjct: 106 LPCGHLFHNSCLRSWLEQDTSCPTCRMSLNIAD 138 >BC069197-1|AAH69197.1| 643|Homo sapiens autocrine motility factor receptor protein. Length = 643 Score = 46.4 bits (105), Expect = 1e-04 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPAD 99 L C HLFH+SC+ WL+ +CP CR SL AD Sbjct: 354 LPCGHLFHNSCLRSWLEQDTSCPTCRMSLNIAD 386 >BC017043-1|AAH17043.1| 292|Homo sapiens AMFR protein protein. Length = 292 Score = 46.4 bits (105), Expect = 1e-04 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPAD 99 L C HLFH+SC+ WL+ +CP CR SL AD Sbjct: 3 LPCGHLFHNSCLRSWLEQDTSCPTCRMSLNIAD 35 >AF124145-1|AAD56722.1| 643|Homo sapiens autocrine motility factor receptor protein. Length = 643 Score = 46.4 bits (105), Expect = 1e-04 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPAD 99 L C HLFH+SC+ WL+ +CP CR SL AD Sbjct: 354 LPCGHLFHNSCLRSWLEQDTSCPTCRMSLNIAD 386 >BC063882-1|AAH63882.1| 1208|Homo sapiens zinc finger DAZ interacting protein 3 protein. Length = 1208 Score = 46.0 bits (104), Expect = 1e-04 Identities = 19/36 (52%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR-RSLLPADPP 105 L C H FH+ CI PWL TCP CR LLP + P Sbjct: 1163 LPCAHKFHAQCIRPWLMQQGTCPTCRLHVLLPEEFP 1198 >AY495710-1|AAS75122.1| 275|Homo sapiens UURF2 ubiquitin ligase protein. Length = 275 Score = 46.0 bits (104), Expect = 1e-04 Identities = 19/36 (52%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR-RSLLPADPP 105 L C H FH+ CI PWL TCP CR LLP + P Sbjct: 230 LPCAHKFHAQCIRPWLMQQGTCPTCRLHVLLPEEFP 265 >AY227652-1|AAO72968.1| 652|Homo sapiens RNA-binding RING-H2 protein-ubiquitin ligase protein. Length = 652 Score = 46.0 bits (104), Expect = 1e-04 Identities = 19/36 (52%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR-RSLLPADPP 105 L C H FH+ CI PWL TCP CR LLP + P Sbjct: 607 LPCAHKFHAQCIRPWLMQQGTCPTCRLHVLLPEEFP 642 >AB014575-1|BAA31650.2| 1217|Homo sapiens KIAA0675 protein protein. Length = 1217 Score = 46.0 bits (104), Expect = 1e-04 Identities = 19/36 (52%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR-RSLLPADPP 105 L C H FH+ CI PWL TCP CR LLP + P Sbjct: 1172 LPCAHKFHAQCIRPWLMQQGTCPTCRLHVLLPEEFP 1207 >Z95113-1|CAI17901.1| 836|Homo sapiens protein ( Human DNA sequence from clone CTA-175E3 on chromosome 22q12.1. ). Length = 836 Score = 44.8 bits (101), Expect = 3e-04 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLL 90 + C H FH C+ PWL H TCP CR +++ Sbjct: 209 IPCTHRFHRKCVDPWLLQHHTCPHCRHNII 238 >CR456397-1|CAG30283.1| 836|Homo sapiens bK175E3.6 protein. Length = 836 Score = 44.8 bits (101), Expect = 3e-04 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLL 90 + C H FH C+ PWL H TCP CR +++ Sbjct: 209 IPCTHRFHRKCVDPWLLQHHTCPHCRHNII 238 >BC109028-1|AAI09029.1| 783|Homo sapiens ring finger protein 43 protein. Length = 783 Score = 44.8 bits (101), Expect = 3e-04 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPAD 99 + C H FH +C+ PWL H TCP+C ++ D Sbjct: 288 ISCLHEFHRNCVDPWLHQHRTCPLCMFNITEGD 320 >BC094857-1|AAH94857.1| 643|Homo sapiens ZNRF3 protein protein. Length = 643 Score = 44.8 bits (101), Expect = 3e-04 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLL 90 + C H FH C+ PWL H TCP CR +++ Sbjct: 16 IPCTHRFHRKCVDPWLLQHHTCPHCRHNII 45 >BC069019-1|AAH69019.1| 643|Homo sapiens ZNRF3 protein protein. Length = 643 Score = 44.8 bits (101), Expect = 3e-04 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLL 90 + C H FH C+ PWL H TCP CR +++ Sbjct: 16 IPCTHRFHRKCVDPWLLQHHTCPHCRHNII 45 >BC021570-1|AAH21570.1| 653|Homo sapiens ZNRF3 protein protein. Length = 653 Score = 44.8 bits (101), Expect = 3e-04 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLL 90 + C H FH C+ PWL H TCP CR +++ Sbjct: 26 IPCTHRFHRKCVDPWLLQHHTCPHCRHNII 55 >AL021393-4|CAI17992.1| 836|Homo sapiens protein ( Human DNA sequence from clone CTA-747E2 on chromosome 22q12.1. ). Length = 836 Score = 44.8 bits (101), Expect = 3e-04 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLL 90 + C H FH C+ PWL H TCP CR +++ Sbjct: 209 IPCTHRFHRKCVDPWLLQHHTCPHCRHNII 238 >AB051436-1|BAB33319.1| 891|Homo sapiens KIAA1133 protein protein. Length = 891 Score = 44.8 bits (101), Expect = 3e-04 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLL 90 + C H FH C+ PWL H TCP CR +++ Sbjct: 264 IPCTHRFHRKCVDPWLLQHHTCPHCRHNII 293 >BC105053-1|AAI05054.1| 643|Homo sapiens praja 1 protein. Length = 643 Score = 44.4 bits (100), Expect = 4e-04 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C H FH C+S WLQ TCP+CR Sbjct: 611 LPCHHYFHKPCVSIWLQKSGTCPVCR 636 >BC105051-1|AAI05052.1| 643|Homo sapiens praja 1 protein. Length = 643 Score = 44.4 bits (100), Expect = 4e-04 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C H FH C+S WLQ TCP+CR Sbjct: 611 LPCHHYFHKPCVSIWLQKSGTCPVCR 636 >BC075803-1|AAH75803.1| 643|Homo sapiens praja 1 protein. Length = 643 Score = 44.4 bits (100), Expect = 4e-04 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C H FH C+S WLQ TCP+CR Sbjct: 611 LPCHHYFHKPCVSIWLQKSGTCPVCR 636 >BC048323-1|AAH48323.1| 384|Homo sapiens PJA1 protein protein. Length = 384 Score = 44.4 bits (100), Expect = 4e-04 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C H FH C+S WLQ TCP+CR Sbjct: 352 LPCHHYFHKPCVSIWLQKSGTCPVCR 377 >BC013357-1|AAH13357.1| 624|Homo sapiens ring finger protein 12 protein. Length = 624 Score = 44.4 bits (100), Expect = 4e-04 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLL 90 L C H +H CI WL ++TCPICRR++L Sbjct: 586 LPCSHEYHVHCIDRWLSENSTCPICRRAVL 615 >AL513007-2|CAI41712.1| 624|Homo sapiens ring finger protein 12 protein. Length = 624 Score = 44.4 bits (100), Expect = 4e-04 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLL 90 L C H +H CI WL ++TCPICRR++L Sbjct: 586 LPCSHEYHVHCIDRWLSENSTCPICRRAVL 615 >AL157699-3|CAI41605.1| 455|Homo sapiens praja 1 protein. Length = 455 Score = 44.4 bits (100), Expect = 4e-04 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C H FH C+S WLQ TCP+CR Sbjct: 423 LPCHHYFHKPCVSIWLQKSGTCPVCR 448 >AL157699-2|CAI41604.1| 643|Homo sapiens praja 1 protein. Length = 643 Score = 44.4 bits (100), Expect = 4e-04 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C H FH C+S WLQ TCP+CR Sbjct: 611 LPCHHYFHKPCVSIWLQKSGTCPVCR 636 >AL157699-1|CAM24741.1| 588|Homo sapiens praja 1 protein. Length = 588 Score = 44.4 bits (100), Expect = 4e-04 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C H FH C+S WLQ TCP+CR Sbjct: 556 LPCHHYFHKPCVSIWLQKSGTCPVCR 581 >AK021892-1|BAB13928.1| 361|Homo sapiens protein ( Homo sapiens cDNA FLJ11830 fis, clone HEMBA1006559, moderately similar to Mus musculus PRAJA1 (Praja1) mRNA. ). Length = 361 Score = 44.4 bits (100), Expect = 4e-04 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C H FH C+S WLQ TCP+CR Sbjct: 329 LPCHHYFHKPCVSIWLQKSGTCPVCR 354 >AK001334-1|BAA91632.1| 624|Homo sapiens protein ( Homo sapiens cDNA FLJ10472 fis, clone NT2RP2000054. ). Length = 624 Score = 44.4 bits (100), Expect = 4e-04 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLL 90 L C H +H CI WL ++TCPICRR++L Sbjct: 586 LPCSHEYHVHCIDRWLSENSTCPICRRAVL 615 >AJ271670-1|CAC14228.1| 624|Homo sapiens RING zinc finger LIM domain binding protein protein. Length = 624 Score = 44.4 bits (100), Expect = 4e-04 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLL 90 L C H +H CI WL ++TCPICRR++L Sbjct: 586 LPCSHEYHVHCIDRWLSENSTCPICRRAVL 615 >AF264620-1|AAM53040.1| 455|Homo sapiens PRAJA1BETA protein. Length = 455 Score = 44.4 bits (100), Expect = 4e-04 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C H FH C+S WLQ TCP+CR Sbjct: 423 LPCHHYFHKPCVSIWLQKSGTCPVCR 448 >AF262024-1|AAM53039.1| 643|Homo sapiens PJA1 protein. Length = 643 Score = 44.4 bits (100), Expect = 4e-04 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C H FH C+S WLQ TCP+CR Sbjct: 611 LPCHHYFHKPCVSIWLQKSGTCPVCR 636 >AF155109-1|AAD42875.1| 483|Homo sapiens putative ring zinc finger protein NY-REN-43 antigen protein. Length = 483 Score = 44.4 bits (100), Expect = 4e-04 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLL 90 L C H +H CI WL ++TCPICRR++L Sbjct: 445 LPCSHEYHVHCIDRWLSENSTCPICRRAVL 474 >AK000322-1|BAA91085.1| 783|Homo sapiens protein ( Homo sapiens cDNA FLJ20315 fis, clone HEP07873. ). Length = 783 Score = 44.0 bits (99), Expect = 6e-04 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPAD 99 + C H FH +C+ PWL H TCP+C ++ D Sbjct: 288 ISCLHEFHRNCVDPWLHQHRTCPLCVFNITEGD 320 >AB081837-1|BAD51435.1| 783|Homo sapiens urcc protein. Length = 783 Score = 44.0 bits (99), Expect = 6e-04 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPAD 99 + C H FH +C+ PWL H TCP+C ++ D Sbjct: 288 ISCLHEFHRNCVDPWLHQHRTCPLCVFNITEGD 320 >BC063297-1|AAH63297.1| 432|Homo sapiens ring finger protein 44 protein. Length = 432 Score = 43.2 bits (97), Expect = 0.001 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C H FH+ C+ WL+ + TCPICR Sbjct: 396 LPCNHEFHTKCVDKWLKANRTCPICR 421 >BC039833-1|AAH39833.1| 432|Homo sapiens ring finger protein 44 protein. Length = 432 Score = 43.2 bits (97), Expect = 0.001 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C H FH+ C+ WL+ + TCPICR Sbjct: 396 LPCNHEFHTKCVDKWLKANRTCPICR 421 >BC033786-1|AAH33786.2| 465|Homo sapiens ring finger protein 38 protein. Length = 465 Score = 43.2 bits (97), Expect = 0.001 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C H FH+ C+ WL+ + TCPICR Sbjct: 429 LPCNHEFHAKCVDKWLKANRTCPICR 454 >AL354935-3|CAO03541.1| 465|Homo sapiens ring finger protein 38 protein. Length = 465 Score = 43.2 bits (97), Expect = 0.001 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C H FH+ C+ WL+ + TCPICR Sbjct: 429 LPCNHEFHAKCVDKWLKANRTCPICR 454 >AL354935-2|CAO03540.1| 515|Homo sapiens ring finger protein 38 protein. Length = 515 Score = 43.2 bits (97), Expect = 0.001 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C H FH+ C+ WL+ + TCPICR Sbjct: 479 LPCNHEFHAKCVDKWLKANRTCPICR 504 >AL354935-1|CAH70194.1| 439|Homo sapiens ring finger protein 38 protein. Length = 439 Score = 43.2 bits (97), Expect = 0.001 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C H FH+ C+ WL+ + TCPICR Sbjct: 403 LPCNHEFHAKCVDKWLKANRTCPICR 428 >AL161792-4|CAO03554.1| 465|Homo sapiens ring finger protein 38 protein. Length = 465 Score = 43.2 bits (97), Expect = 0.001 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C H FH+ C+ WL+ + TCPICR Sbjct: 429 LPCNHEFHAKCVDKWLKANRTCPICR 454 >AL161792-3|CAO03553.1| 515|Homo sapiens ring finger protein 38 protein. Length = 515 Score = 43.2 bits (97), Expect = 0.001 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C H FH+ C+ WL+ + TCPICR Sbjct: 479 LPCNHEFHAKCVDKWLKANRTCPICR 504 >AL161792-1|CAI16895.1| 439|Homo sapiens ring finger protein 38 protein. Length = 439 Score = 43.2 bits (97), Expect = 0.001 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C H FH+ C+ WL+ + TCPICR Sbjct: 403 LPCNHEFHAKCVDKWLKANRTCPICR 428 >AK024996-1|BAB15050.1| 332|Homo sapiens protein ( Homo sapiens cDNA: FLJ21343 fis, clone COL02679. ). Length = 332 Score = 43.2 bits (97), Expect = 0.001 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C H FH+ C+ WL+ + TCPICR Sbjct: 296 LPCNHEFHAKCVDKWLKANRTCPICR 321 >AF394047-1|AAM73697.1| 432|Homo sapiens RING finger protein 38 protein. Length = 432 Score = 43.2 bits (97), Expect = 0.001 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C H FH+ C+ WL+ + TCPICR Sbjct: 396 LPCNHEFHAKCVDKWLKANRTCPICR 421 >AB029023-1|BAA83052.2| 444|Homo sapiens KIAA1100 protein protein. Length = 444 Score = 43.2 bits (97), Expect = 0.001 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C H FH+ C+ WL+ + TCPICR Sbjct: 408 LPCNHEFHTKCVDKWLKANRTCPICR 433 >CR456804-1|CAG33085.1| 381|Homo sapiens RNF13 protein. Length = 381 Score = 42.7 bits (96), Expect = 0.001 Identities = 13/33 (39%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +1 Query: 1 LECEHLFHSSCISPWL-QLHATCPICRRSLLPA 96 L C H +H C+ PWL + TCP+C++ ++P+ Sbjct: 256 LPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPS 288 >BC009803-1|AAH09803.1| 381|Homo sapiens ring finger protein 13 protein. Length = 381 Score = 42.7 bits (96), Expect = 0.001 Identities = 13/33 (39%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +1 Query: 1 LECEHLFHSSCISPWL-QLHATCPICRRSLLPA 96 L C H +H C+ PWL + TCP+C++ ++P+ Sbjct: 256 LPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPS 288 >BC009781-1|AAH09781.1| 381|Homo sapiens ring finger protein 13 protein. Length = 381 Score = 42.7 bits (96), Expect = 0.001 Identities = 13/33 (39%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +1 Query: 1 LECEHLFHSSCISPWL-QLHATCPICRRSLLPA 96 L C H +H C+ PWL + TCP+C++ ++P+ Sbjct: 256 LPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPS 288 >AF070558-1|AAC28641.1| 381|Homo sapiens RING zinc finger protein RZF protein. Length = 381 Score = 42.7 bits (96), Expect = 0.001 Identities = 13/33 (39%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +1 Query: 1 LECEHLFHSSCISPWL-QLHATCPICRRSLLPA 96 L C H +H C+ PWL + TCP+C++ ++P+ Sbjct: 256 LPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPS 288 >AF037204-1|AAC03769.1| 381|Homo sapiens RING zinc finger protein protein. Length = 381 Score = 42.7 bits (96), Expect = 0.001 Identities = 13/33 (39%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +1 Query: 1 LECEHLFHSSCISPWL-QLHATCPICRRSLLPA 96 L C H +H C+ PWL + TCP+C++ ++P+ Sbjct: 256 LPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPS 288 >CR457340-1|CAG33621.1| 350|Homo sapiens DKFZP566H073 protein. Length = 350 Score = 42.3 bits (95), Expect = 0.002 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 1 LECEHLFHSSCISPWL-QLHATCPICRR 81 L C H +HS C+ PWL Q TCPIC++ Sbjct: 246 LPCAHAYHSRCVDPWLTQTRKTCPICKQ 273 >BC010139-1|AAH10139.1| 350|Homo sapiens ring finger protein 167 protein. Length = 350 Score = 42.3 bits (95), Expect = 0.002 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 1 LECEHLFHSSCISPWL-QLHATCPICRR 81 L C H +HS C+ PWL Q TCPIC++ Sbjct: 246 LPCAHAYHSRCVDPWLTQTRKTCPICKQ 273 >AL834284-1|CAD38958.1| 349|Homo sapiens hypothetical protein protein. Length = 349 Score = 42.3 bits (95), Expect = 0.002 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 1 LECEHLFHSSCISPWL-QLHATCPICRR 81 L C H +HS C+ PWL Q TCPIC++ Sbjct: 245 LPCAHAYHSRCVDPWLTQTRKTCPICKQ 272 >AL050060-1|CAB43253.1| 324|Homo sapiens hypothetical protein protein. Length = 324 Score = 42.3 bits (95), Expect = 0.002 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 1 LECEHLFHSSCISPWL-QLHATCPICRR 81 L C H +HS C+ PWL Q TCPIC++ Sbjct: 220 LPCAHAYHSRCVDPWLTQTRKTCPICKQ 247 >AK025329-1|BAB15113.1| 350|Homo sapiens protein ( Homo sapiens cDNA: FLJ21676 fis, clone COL09164. ). Length = 350 Score = 42.3 bits (95), Expect = 0.002 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 1 LECEHLFHSSCISPWL-QLHATCPICRR 81 L C H +HS C+ PWL Q TCPIC++ Sbjct: 246 LPCAHAYHSRCVDPWLTQTRKTCPICKQ 273 >BC034688-1|AAH34688.1| 685|Homo sapiens ring finger protein (C3H2C3 type) 6 protein. Length = 685 Score = 41.9 bits (94), Expect = 0.002 Identities = 16/30 (53%), Positives = 19/30 (63%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLL 90 L C H FH CI WL + TCPICR+ +L Sbjct: 648 LPCMHEFHIHCIDRWLSENCTCPICRQPVL 677 >AY009109-1|AAG49400.1| 685|Homo sapiens ring-H2 protein protein. Length = 685 Score = 41.9 bits (94), Expect = 0.002 Identities = 16/30 (53%), Positives = 19/30 (63%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLL 90 L C H FH CI WL + TCPICR+ +L Sbjct: 648 LPCMHEFHIHCIDRWLSENCTCPICRQPVL 677 >AL138966-3|CAH73183.1| 685|Homo sapiens ring finger protein (C3H2C3 type) 6 protein. Length = 685 Score = 41.9 bits (94), Expect = 0.002 Identities = 16/30 (53%), Positives = 19/30 (63%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLL 90 L C H FH CI WL + TCPICR+ +L Sbjct: 648 LPCMHEFHIHCIDRWLSENCTCPICRQPVL 677 >AJ010347-1|CAB40414.1| 685|Homo sapiens RING-H2 protein. Length = 685 Score = 41.9 bits (94), Expect = 0.002 Identities = 16/30 (53%), Positives = 19/30 (63%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLL 90 L C H FH CI WL + TCPICR+ +L Sbjct: 648 LPCMHEFHIHCIDRWLSENCTCPICRQPVL 677 >AJ010346-1|CAB40413.1| 685|Homo sapiens RING-H2 protein. Length = 685 Score = 41.9 bits (94), Expect = 0.002 Identities = 16/30 (53%), Positives = 19/30 (63%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLL 90 L C H FH CI WL + TCPICR+ +L Sbjct: 648 LPCMHEFHIHCIDRWLSENCTCPICRQPVL 677 >AK127467-1|BAC86992.1| 346|Homo sapiens protein ( Homo sapiens cDNA FLJ45559 fis, clone BRTHA3003225. ). Length = 346 Score = 41.1 bits (92), Expect = 0.004 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C HLFH C+ WL + CPICR Sbjct: 310 LPCMHLFHQLCVDQWLAMSKKCPICR 335 >AK131304-1|BAD18471.1| 994|Homo sapiens protein ( Homo sapiens cDNA FLJ16278 fis, clone NT2RI3001132, highly similar to Mus musculus Arkadia (Arkadia) mRNA. ). Length = 994 Score = 40.3 bits (90), Expect = 0.007 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C HLFH C+ WL + CPICR Sbjct: 958 LPCMHLFHQVCVDQWLVTNKKCPICR 983 >BX538130-1|CAD98031.1| 986|Homo sapiens hypothetical protein protein. Length = 986 Score = 39.9 bits (89), Expect = 0.009 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C HLFH C+ WL + CPICR Sbjct: 950 LPCMHLFHQVCVDQWLITNKKCPICR 975 >BC101573-1|AAI01574.1| 155|Homo sapiens ring finger protein 122 protein. Length = 155 Score = 39.9 bits (89), Expect = 0.009 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSL 87 L C+H FH C+ WL++ CP+C + + Sbjct: 109 LPCQHAFHRKCLVKWLEVRCVCPMCNKPI 137 >BC093884-1|AAH93884.1| 155|Homo sapiens ring finger protein 122 protein. Length = 155 Score = 39.9 bits (89), Expect = 0.009 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSL 87 L C+H FH C+ WL++ CP+C + + Sbjct: 109 LPCQHAFHRKCLVKWLEVRCVCPMCNKPI 137 >BC060862-1|AAH60862.1| 985|Homo sapiens ring finger protein 111 protein. Length = 985 Score = 39.9 bits (89), Expect = 0.009 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C HLFH C+ WL + CPICR Sbjct: 949 LPCMHLFHQVCVDQWLITNKKCPICR 974 >BC020984-1|AAH20984.1| 441|Homo sapiens RNF111 protein protein. Length = 441 Score = 39.9 bits (89), Expect = 0.009 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C HLFH C+ WL + CPICR Sbjct: 405 LPCMHLFHQVCVDQWLITNKKCPICR 430 >BC010369-1|AAH10369.1| 137|Homo sapiens RNF111 protein protein. Length = 137 Score = 39.9 bits (89), Expect = 0.009 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C HLFH C+ WL + CPICR Sbjct: 101 LPCMHLFHQVCVDQWLITNKKCPICR 126 >AK131488-1|BAD18633.1| 602|Homo sapiens protein ( Homo sapiens cDNA FLJ16671 fis, clone THYMU3001428. ). Length = 602 Score = 39.9 bits (89), Expect = 0.009 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C HLFH C+ WL + CPICR Sbjct: 566 LPCMHLFHQVCVDQWLITNKKCPICR 591 >AK095327-1|BAC04531.1| 370|Homo sapiens protein ( Homo sapiens cDNA FLJ38008 fis, clone CTONG2012452, highly similar to Mus musculus Arkadia (Arkadia) mRNA. ). Length = 370 Score = 39.9 bits (89), Expect = 0.009 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C HLFH C+ WL + CPICR Sbjct: 334 LPCMHLFHQVCVDQWLITNKKCPICR 359 >AK022588-1|BAB14115.1| 155|Homo sapiens protein ( Homo sapiens cDNA FLJ12526 fis, clone NT2RM4000046, weakly similar to GOLIATH PROTEIN. ). Length = 155 Score = 39.9 bits (89), Expect = 0.009 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSL 87 L C+H FH C+ WL++ CP+C + + Sbjct: 109 LPCQHAFHRKCLVKWLEVRCVCPMCNKPI 137 >BX537635-1|CAD97802.1| 120|Homo sapiens hypothetical protein protein. Length = 120 Score = 39.5 bits (88), Expect = 0.012 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPIC 75 C H FH+ C+ WL + TCP+C Sbjct: 9 CSHFFHAGCLKKWLYVQETCPLC 31 >BC042684-1|AAH42684.1| 663|Homo sapiens RNF145 protein protein. Length = 663 Score = 39.5 bits (88), Expect = 0.012 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPIC 75 C H FH+ C+ WL + TCP+C Sbjct: 552 CSHFFHAGCLKKWLYVQETCPLC 574 >AL831829-1|CAD38542.1| 121|Homo sapiens hypothetical protein protein. Length = 121 Score = 39.5 bits (88), Expect = 0.012 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPIC 75 C H FH+ C+ WL + TCP+C Sbjct: 10 CSHFFHAGCLKKWLYVQETCPLC 32 >AK098802-1|BAC05416.1| 268|Homo sapiens protein ( Homo sapiens cDNA FLJ25936 fis, clone JTH07108. ). Length = 268 Score = 39.5 bits (88), Expect = 0.012 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPIC 75 C H FH+ C+ WL + TCP+C Sbjct: 157 CSHFFHAGCLKKWLYVQETCPLC 179 >AK075101-1|BAC11401.1| 217|Homo sapiens protein ( Homo sapiens cDNA FLJ90620 fis, clone PLACE1002518. ). Length = 217 Score = 39.5 bits (88), Expect = 0.012 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPIC 75 C H FH+ C+ WL + TCP+C Sbjct: 106 CSHFFHAGCLKKWLYVQETCPLC 128 >AK056513-1|BAB71200.1| 691|Homo sapiens protein ( Homo sapiens cDNA FLJ31951 fis, clone NT2RP7007177, weakly similar to Homo sapiens multiple membrane spanning receptor TRC8 mRNA. ). Length = 691 Score = 39.5 bits (88), Expect = 0.012 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPIC 75 C H FH+ C+ WL + TCP+C Sbjct: 580 CSHFFHAGCLKKWLYVQETCPLC 602 >BC064636-1|AAH64636.1| 664|Homo sapiens ring finger protein 139 protein. Length = 664 Score = 38.7 bits (86), Expect = 0.022 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICRRSLLPAD 99 C H FH+ C+ WL + TCP+C + + D Sbjct: 563 CNHYFHALCLRKWLYIQDTCPMCHQKVYIED 593 >BC021571-1|AAH21571.1| 664|Homo sapiens ring finger protein 139 protein. Length = 664 Score = 38.7 bits (86), Expect = 0.022 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICRRSLLPAD 99 C H FH+ C+ WL + TCP+C + + D Sbjct: 563 CNHYFHALCLRKWLYIQDTCPMCHQKVYIED 593 >BC017878-1|AAH17878.1| 291|Homo sapiens RNF13 protein protein. Length = 291 Score = 38.7 bits (86), Expect = 0.022 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +1 Query: 1 LECEHLFHSSCISPWL-QLHATCPICRR 81 L C H +H C+ PWL + TCP+C++ Sbjct: 256 LPCSHAYHCKCVDPWLTKTKKTCPVCKQ 283 >AF064801-1|AAC39930.1| 664|Homo sapiens multiple membrane spanning receptor TRC8 protein. Length = 664 Score = 38.7 bits (86), Expect = 0.022 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICRRSLLPAD 99 C H FH+ C+ WL + TCP+C + + D Sbjct: 563 CNHYFHALCLRKWLYIQDTCPMCHQKVYIED 593 >BT007406-1|AAP36074.1| 148|Homo sapiens ring finger protein 24 protein. Length = 148 Score = 38.3 bits (85), Expect = 0.029 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICRRSLL 90 C+H FH C+ WL++ CP+C +L Sbjct: 96 CKHAFHRKCLIKWLEVRKVCPLCNMPVL 123 >BC039584-1|AAH39584.1| 148|Homo sapiens RNF24 protein protein. Length = 148 Score = 38.3 bits (85), Expect = 0.029 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICRRSLL 90 C+H FH C+ WL++ CP+C +L Sbjct: 96 CKHAFHRKCLIKWLEVRKVCPLCNMPVL 123 >BC000213-1|AAH00213.1| 148|Homo sapiens RNF24 protein protein. Length = 148 Score = 38.3 bits (85), Expect = 0.029 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICRRSLL 90 C+H FH C+ WL++ CP+C +L Sbjct: 96 CKHAFHRKCLIKWLEVRKVCPLCNMPVL 123 >AL096778-1|CAB46627.1| 148|Homo sapiens hypothetical protein protein. Length = 148 Score = 38.3 bits (85), Expect = 0.029 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICRRSLL 90 C+H FH C+ WL++ CP+C +L Sbjct: 96 CKHAFHRKCLIKWLEVRKVCPLCNMPVL 123 >AL079313-1|CAB45279.1| 104|Homo sapiens hypothetical protein, similar to (M97204) goliath.5 homolog [Drosophila melanog protein. Length = 104 Score = 38.3 bits (85), Expect = 0.029 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICRRSLL 90 C+H FH C+ WL++ CP+C +L Sbjct: 52 CKHAFHRKCLIKWLEVRKVCPLCNMPVL 79 >AL031670-4|CAB43182.1| 148|Homo sapiens ring finger protein 24 protein. Length = 148 Score = 38.3 bits (85), Expect = 0.029 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICRRSLL 90 C+H FH C+ WL++ CP+C +L Sbjct: 96 CKHAFHRKCLIKWLEVRKVCPLCNMPVL 123 >D84296-1|BAA12303.1| 1715|Homo sapiens TPRDIII protein. Length = 1715 Score = 37.5 bits (83), Expect = 0.050 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR-RSLLPADPP 105 L+C H +H C WL+ + CP C+ R LL + P Sbjct: 1662 LKCGHKYHKGCFKQWLKGQSACPACQGRDLLTEESP 1697 >D84295-1|BAA12302.1| 1792|Homo sapiens possible protein TPRDII protein. Length = 1792 Score = 37.5 bits (83), Expect = 0.050 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR-RSLLPADPP 105 L+C H +H C WL+ + CP C+ R LL + P Sbjct: 1739 LKCGHKYHKGCFKQWLKGQSACPACQGRDLLTEESP 1774 >D84294-1|BAA12301.1| 2025|Homo sapiens TPRDI protein. Length = 2025 Score = 37.5 bits (83), Expect = 0.050 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR-RSLLPADPP 105 L+C H +H C WL+ + CP C+ R LL + P Sbjct: 1972 LKCGHKYHKGCFKQWLKGQSACPACQGRDLLTEESP 2007 >D83327-1|BAA23666.1| 1941|Homo sapiens DCRR1 protein. Length = 1941 Score = 37.5 bits (83), Expect = 0.050 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR-RSLLPADPP 105 L+C H +H C WL+ + CP C+ R LL + P Sbjct: 1888 LKCGHKYHKGCFKQWLKGQSACPACQGRDLLTEESP 1923 >D83077-1|BAA11769.1| 2025|Homo sapiens TPRD protein. Length = 2025 Score = 37.5 bits (83), Expect = 0.050 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR-RSLLPADPP 105 L+C H +H C WL+ + CP C+ R LL + P Sbjct: 1972 LKCGHKYHKGCFKQWLKGQSACPACQGRDLLTEESP 2007 >BT007446-1|AAP36114.1| 485|Homo sapiens ring finger protein (C3HC4 type) 8 protein. Length = 485 Score = 37.5 bits (83), Expect = 0.050 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSL 87 L C H F S CI+ W++ CPICR+ + Sbjct: 416 LNCAHSFCSYCINEWMKRKIECPICRKDI 444 >BT007348-1|AAP36012.1| 113|Homo sapiens ring finger protein 7 protein. Length = 113 Score = 37.5 bits (83), Expect = 0.050 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +1 Query: 4 ECEHLFHSSCISPWLQLHATCPICRR 81 EC H FH+ C+S W++ + CP+C++ Sbjct: 79 ECNHSFHNCCMSLWVKQNNRCPLCQQ 104 >BC008627-1|AAH08627.1| 113|Homo sapiens ring finger protein 7 protein. Length = 113 Score = 37.5 bits (83), Expect = 0.050 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +1 Query: 4 ECEHLFHSSCISPWLQLHATCPICRR 81 EC H FH+ C+S W++ + CP+C++ Sbjct: 79 ECNHSFHNCCMSLWVKQNNRCPLCQQ 104 >BC007517-1|AAH07517.1| 485|Homo sapiens ring finger protein 8 protein. Length = 485 Score = 37.5 bits (83), Expect = 0.050 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSL 87 L C H F S CI+ W++ CPICR+ + Sbjct: 416 LNCAHSFCSYCINEWMKRKIECPICRKDI 444 >BC005966-1|AAH05966.1| 113|Homo sapiens ring finger protein 7 protein. Length = 113 Score = 37.5 bits (83), Expect = 0.050 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +1 Query: 4 ECEHLFHSSCISPWLQLHATCPICRR 81 EC H FH+ C+S W++ + CP+C++ Sbjct: 79 ECNHSFHNCCMSLWVKQNNRCPLCQQ 104 >AL096712-1|CAB75689.1| 485|Homo sapiens ring finger protein 8 protein. Length = 485 Score = 37.5 bits (83), Expect = 0.050 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSL 87 L C H F S CI+ W++ CPICR+ + Sbjct: 416 LNCAHSFCSYCINEWMKRKIECPICRKDI 444 >AK222765-1|BAD96485.1| 485|Homo sapiens ring finger protein 8 isoform 1 variant protein. Length = 485 Score = 37.5 bits (83), Expect = 0.050 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSL 87 L C H F S CI+ W++ CPICR+ + Sbjct: 416 LNCAHSFCSYCINEWMKRKIECPICRKDI 444 >AF334675-1|AAQ14887.1| 485|Homo sapiens UBC13/UEV-interacting ring finger protein protein. Length = 485 Score = 37.5 bits (83), Expect = 0.050 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSL 87 L C H F S CI+ W++ CPICR+ + Sbjct: 416 LNCAHSFCSYCINEWMKRKIECPICRKDI 444 >AF164679-1|AAD55984.1| 113|Homo sapiens ring finger protein CKBBP1 protein. Length = 113 Score = 37.5 bits (83), Expect = 0.050 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +1 Query: 4 ECEHLFHSSCISPWLQLHATCPICRR 81 EC H FH+ C+S W++ + CP+C++ Sbjct: 79 ECNHSFHNCCMSLWVKQNNRCPLCQQ 104 >AF142060-1|AAD30147.1| 113|Homo sapiens RING finger protein protein. Length = 113 Score = 37.5 bits (83), Expect = 0.050 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +1 Query: 4 ECEHLFHSSCISPWLQLHATCPICRR 81 EC H FH+ C+S W++ + CP+C++ Sbjct: 79 ECNHSFHNCCMSLWVKQNNRCPLCQQ 104 >AF092878-1|AAD25962.1| 113|Homo sapiens zinc RING finger protein SAG protein. Length = 113 Score = 37.5 bits (83), Expect = 0.050 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +1 Query: 4 ECEHLFHSSCISPWLQLHATCPICRR 81 EC H FH+ C+S W++ + CP+C++ Sbjct: 79 ECNHSFHNCCMSLWVKQNNRCPLCQQ 104 >AB014546-1|BAA31621.2| 486|Homo sapiens KIAA0646 protein protein. Length = 486 Score = 37.5 bits (83), Expect = 0.050 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSL 87 L C H F S CI+ W++ CPICR+ + Sbjct: 417 LNCAHSFCSYCINEWMKRKIECPICRKDI 445 >AB012770-1|BAA33557.1| 485|Homo sapiens new zinc finger protein protein. Length = 485 Score = 37.5 bits (83), Expect = 0.050 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSL 87 L C H F S CI+ W++ CPICR+ + Sbjct: 416 LNCAHSFCSYCINEWMKRKIECPICRKDI 444 >BT006662-1|AAP35308.1| 230|Homo sapiens C3HC4-like zinc finger protein protein. Length = 230 Score = 37.1 bits (82), Expect = 0.067 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPAD 99 L C H F CI W H CPICR + A+ Sbjct: 167 LPCAHSFCQKCIDKWSDRHRNCPICRLQMTGAN 199 >BC113014-1|AAI13015.1| 245|Homo sapiens ring finger protein 151 protein. Length = 245 Score = 37.1 bits (82), Expect = 0.067 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSL 87 L C H+F CI WL TCP CR+ + Sbjct: 33 LPCSHIFCKKCILRWLARQKTCPCCRKEV 61 >BC029501-1|AAH29501.2| 244|Homo sapiens RNF151 protein protein. Length = 244 Score = 37.1 bits (82), Expect = 0.067 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSL 87 L C H+F CI WL TCP CR+ + Sbjct: 32 LPCSHIFCKKCILRWLARQKTCPCCRKEV 60 >BC018104-1|AAH18104.1| 230|Homo sapiens ring finger protein 141 protein. Length = 230 Score = 37.1 bits (82), Expect = 0.067 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPAD 99 L C H F CI W H CPICR + A+ Sbjct: 167 LPCAHSFCQKCIDKWSDRHRNCPICRLQMTGAN 199 >AF214680-1|AAF30180.1| 230|Homo sapiens C3HC4-like zinc finger protein protein. Length = 230 Score = 37.1 bits (82), Expect = 0.067 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICRRSLLPAD 99 L C H F CI W H CPICR + A+ Sbjct: 167 LPCAHSFCQKCIDKWSDRHRNCPICRLQMTGAN 199 >BC017592-1|AAH17592.2| 429|Homo sapiens zinc and ring finger 4 protein. Length = 429 Score = 36.7 bits (81), Expect = 0.088 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQL--HATCPICRRSL 87 L C H +H CI PW +CP+C++S+ Sbjct: 325 LPCSHTYHCKCIDPWFSQAPRRSCPVCKQSV 355 >AC005764-1|AAC62428.1| 420|Homo sapiens R31343_1 protein. Length = 420 Score = 36.7 bits (81), Expect = 0.088 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQL--HATCPICRRSL 87 L C H +H CI PW +CP+C++S+ Sbjct: 316 LPCSHTYHCKCIDPWFSQAPRRSCPVCKQSV 346 >BC047654-1|AAH47654.1| 154|Homo sapiens ring finger protein 11 protein. Length = 154 Score = 35.9 bits (79), Expect = 0.15 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPIC 75 L C H++H CI WL TCP C Sbjct: 115 LPCMHIYHLDCIDDWLMRSFTCPSC 139 >BC020964-1|AAH20964.1| 154|Homo sapiens ring finger protein 11 protein. Length = 154 Score = 35.9 bits (79), Expect = 0.15 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPIC 75 L C H++H CI WL TCP C Sbjct: 115 LPCMHIYHLDCIDDWLMRSFTCPSC 139 >AL162430-11|CAI13140.1| 154|Homo sapiens ring finger protein 11 protein. Length = 154 Score = 35.9 bits (79), Expect = 0.15 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPIC 75 L C H++H CI WL TCP C Sbjct: 115 LPCMHIYHLDCIDDWLMRSFTCPSC 139 >AF151881-1|AAD34118.1| 154|Homo sapiens CGI-123 protein protein. Length = 154 Score = 35.9 bits (79), Expect = 0.15 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPIC 75 L C H++H CI WL TCP C Sbjct: 115 LPCMHIYHLDCIDDWLMRSFTCPSC 139 >AB024703-1|BAA84683.1| 154|Homo sapiens Sid1669p protein. Length = 154 Score = 35.9 bits (79), Expect = 0.15 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPIC 75 L C H++H CI WL TCP C Sbjct: 115 LPCMHIYHLDCIDDWLMRSFTCPSC 139 >CR542077-1|CAG46874.1| 326|Homo sapiens PEX10 protein. Length = 326 Score = 35.5 bits (78), Expect = 0.20 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICRRSLLP 93 C HLF CI+ W A CP+CR P Sbjct: 288 CGHLFCWECITAWCSSKAECPLCREKFPP 316 >BC088365-1|AAH88365.2| 435|Homo sapiens PTD016 protein protein. Length = 435 Score = 35.5 bits (78), Expect = 0.20 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C+H+F C++ W TCP+CR Sbjct: 388 LICQHIFCEECMTLWFNREKTCPLCR 413 >BC018198-1|AAH18198.1| 326|Homo sapiens peroxisome biogenesis factor 10 protein. Length = 326 Score = 35.5 bits (78), Expect = 0.20 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICRRSLLP 93 C HLF CI+ W A CP+CR P Sbjct: 288 CGHLFCWECITAWCSSKAECPLCREKFPP 316 >BC000543-1|AAH00543.1| 346|Homo sapiens peroxisome biogenesis factor 10 protein. Length = 346 Score = 35.5 bits (78), Expect = 0.20 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICRRSLLP 93 C HLF CI+ W A CP+CR P Sbjct: 308 CGHLFCWECITAWCSSKAECPLCREKFPP 336 >AL513477-1|CAI22603.1| 346|Homo sapiens peroxisome biogenesis factor 10 protein. Length = 346 Score = 35.5 bits (78), Expect = 0.20 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICRRSLLP 93 C HLF CI+ W A CP+CR P Sbjct: 308 CGHLFCWECITAWCSSKAECPLCREKFPP 336 >AL445209-2|CAI15183.1| 726|Homo sapiens chromosome 13 open reading frame 7 protein. Length = 726 Score = 35.5 bits (78), Expect = 0.20 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 13 HLFHSSCISPWLQLHATCPICRRSLLPADP 102 H+F S CI WL+ ++ CP CR + P +P Sbjct: 35 HVFCSICIDLWLKNNSQCPACRVPITPENP 64 >AL139319-1|CAH70397.1| 726|Homo sapiens chromosome 13 open reading frame 7 protein. Length = 726 Score = 35.5 bits (78), Expect = 0.20 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 13 HLFHSSCISPWLQLHATCPICRRSLLPADP 102 H+F S CI WL+ ++ CP CR + P +P Sbjct: 35 HVFCSICIDLWLKNNSQCPACRVPITPENP 64 >AK098649-1|BAC05364.1| 252|Homo sapiens protein ( Homo sapiens cDNA FLJ25783 fis, clone TST06726. ). Length = 252 Score = 35.5 bits (78), Expect = 0.20 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQLHATCPICR 78 L C+H+F C++ W TCP+CR Sbjct: 205 LICQHIFCEECMTLWFNREKTCPLCR 230 >AF060502-1|AAC18133.1| 326|Homo sapiens peroxisome assembly protein PEX10 protein. Length = 326 Score = 35.5 bits (78), Expect = 0.20 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICRRSLLP 93 C HLF CI+ W A CP+CR P Sbjct: 288 CGHLFCWECITAWCSSKAECPLCREKFPP 316 >AB013818-1|BAA87895.1| 326|Homo sapiens peroxisome biogenesis factor (peroxin) 10 protein. Length = 326 Score = 35.5 bits (78), Expect = 0.20 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICRRSLLP 93 C HLF CI+ W A CP+CR P Sbjct: 288 CGHLFCWECITAWCSSKAECPLCREKFPP 316 >AL079315-1|CAB45281.1| 158|Homo sapiens hypothetical protein protein. Length = 158 Score = 35.1 bits (77), Expect = 0.27 Identities = 12/22 (54%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = +1 Query: 19 FHSSCISPWL-QLHATCPICRR 81 +HS C+ PWL Q TCPIC++ Sbjct: 60 YHSRCVDPWLTQTRKTCPICKQ 81 >CR456560-1|CAG30446.1| 108|Homo sapiens RBX1 protein. Length = 108 Score = 34.7 bits (76), Expect = 0.35 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICRR 81 C H FH CIS WL+ CP+ R Sbjct: 75 CNHAFHFHCISRWLKTRQVCPLDNR 99 >BC017370-1|AAH17370.2| 115|Homo sapiens RBX1 protein protein. Length = 115 Score = 34.7 bits (76), Expect = 0.35 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICRR 81 C H FH CIS WL+ CP+ R Sbjct: 82 CNHAFHFHCISRWLKTRQVCPLDNR 106 >BC001466-1|AAH01466.1| 108|Homo sapiens ring-box 1 protein. Length = 108 Score = 34.7 bits (76), Expect = 0.35 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICRR 81 C H FH CIS WL+ CP+ R Sbjct: 75 CNHAFHFHCISRWLKTRQVCPLDNR 99 >AY099360-1|AAM21718.1| 95|Homo sapiens ZYP protein protein. Length = 95 Score = 34.7 bits (76), Expect = 0.35 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICRR 81 C H FH CIS WL+ CP+ R Sbjct: 62 CNHAFHFHCISRWLKTRQVCPLDNR 86 >AL080242-1|CAB62925.1| 108|Homo sapiens ring-box 1 protein. Length = 108 Score = 34.7 bits (76), Expect = 0.35 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICRR 81 C H FH CIS WL+ CP+ R Sbjct: 75 CNHAFHFHCISRWLKTRQVCPLDNR 99 >AF142059-1|AAD30146.1| 108|Homo sapiens RING finger protein protein. Length = 108 Score = 34.7 bits (76), Expect = 0.35 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICRR 81 C H FH CIS WL+ CP+ R Sbjct: 75 CNHAFHFHCISRWLKTRQVCPLDNR 99 >AF140598-1|AAD29715.1| 108|Homo sapiens ring-box protein 1 protein. Length = 108 Score = 34.7 bits (76), Expect = 0.35 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICRR 81 C H FH CIS WL+ CP+ R Sbjct: 75 CNHAFHFHCISRWLKTRQVCPLDNR 99 >BC104641-1|AAI04642.1| 84|Homo sapiens ANAPC11 protein protein. Length = 84 Score = 34.3 bits (75), Expect = 0.47 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 3/29 (10%) Frame = +1 Query: 4 ECEHLFHSSCISPWL---QLHATCPICRR 81 +C H FH CI WL Q+ CP+CR+ Sbjct: 50 QCSHCFHMHCILKWLHAQQVQQHCPMCRQ 78 >BC095454-1|AAH95454.1| 84|Homo sapiens APC11 anaphase promoting complex subunit 11 homolog (yeast) protein. Length = 84 Score = 34.3 bits (75), Expect = 0.47 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 3/29 (10%) Frame = +1 Query: 4 ECEHLFHSSCISPWL---QLHATCPICRR 81 +C H FH CI WL Q+ CP+CR+ Sbjct: 50 QCSHCFHMHCILKWLHAQQVQQHCPMCRQ 78 >BC066308-1|AAH66308.1| 84|Homo sapiens APC11 anaphase promoting complex subunit 11 homolog (yeast) protein. Length = 84 Score = 34.3 bits (75), Expect = 0.47 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 3/29 (10%) Frame = +1 Query: 4 ECEHLFHSSCISPWL---QLHATCPICRR 81 +C H FH CI WL Q+ CP+CR+ Sbjct: 50 QCSHCFHMHCILKWLHAQQVQQHCPMCRQ 78 >AY332222-1|AAP93638.1| 592|Homo sapiens impedes mitogenic signal propagation protein. Length = 592 Score = 34.3 bits (75), Expect = 0.47 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICRRSLLP 93 C H FHS C+ W TCP+CR P Sbjct: 283 CNHSFHSQCLQRWDD--TTCPVCRYCQTP 309 >AF247789-1|AAL95694.1| 84|Homo sapiens putative anaphase-promoting complex subunit APC11 protein. Length = 84 Score = 34.3 bits (75), Expect = 0.47 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 3/29 (10%) Frame = +1 Query: 4 ECEHLFHSSCISPWL---QLHATCPICRR 81 +C H FH CI WL Q+ CP+CR+ Sbjct: 50 QCSHCFHMHCILKWLHAQQVQQHCPMCRQ 78 >AF247565-1|AAF65816.1| 84|Homo sapiens anaphase promoting complex subunit 11 protein. Length = 84 Score = 34.3 bits (75), Expect = 0.47 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 3/29 (10%) Frame = +1 Query: 4 ECEHLFHSSCISPWL---QLHATCPICRR 81 +C H FH CI WL Q+ CP+CR+ Sbjct: 50 QCSHCFHMHCILKWLHAQQVQQHCPMCRQ 78 >AF035620-1|AAC24200.1| 600|Homo sapiens BRCA1-associated protein 2 protein. Length = 600 Score = 34.3 bits (75), Expect = 0.47 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICRRSLLP 93 C H FHS C+ W TCP+CR P Sbjct: 283 CNHSFHSQCLQRWDD--TTCPVCRYCQTP 309 >AB208878-1|BAD92115.1| 632|Homo sapiens BRCA1 associated protein variant protein. Length = 632 Score = 34.3 bits (75), Expect = 0.47 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICRRSLLP 93 C H FHS C+ W TCP+CR P Sbjct: 323 CNHSFHSQCLQRWDD--TTCPVCRYCQTP 349 >BC032637-1|AAH32637.1| 317|Homo sapiens ring finger protein 41 protein. Length = 317 Score = 33.5 bits (73), Expect = 0.82 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICR 78 CEH F ++CI+ W TCP+ R Sbjct: 34 CEHAFCNACITQWFSQQQTCPVDR 57 >AF077599-1|AAC27647.1| 317|Homo sapiens hypothetical SBBI03 protein protein. Length = 317 Score = 33.5 bits (73), Expect = 0.82 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICR 78 CEH F ++CI+ W TCP+ R Sbjct: 34 CEHAFCNACITQWFSQQQTCPVDR 57 >D76444-1|BAA19739.1| 685|Homo sapiens hkf-1 protein. Length = 685 Score = 33.1 bits (72), Expect = 1.1 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQ-LHATCPICR 78 L C H+FH +CI WL CP+CR Sbjct: 637 LPCGHVFHQNCIVMWLAGGRHCCPVCR 663 >BC110333-1|AAI10334.1| 685|Homo sapiens ring finger protein 103 protein. Length = 685 Score = 33.1 bits (72), Expect = 1.1 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQ-LHATCPICR 78 L C H+FH +CI WL CP+CR Sbjct: 637 LPCGHVFHQNCIVMWLAGGRHCCPVCR 663 >BC069226-1|AAH69226.1| 493|Homo sapiens tripartite motif-containing 35 protein. Length = 493 Score = 33.1 bits (72), Expect = 1.1 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +1 Query: 1 LECEHLFHSSCISP-W-LQLHATCPICRRSLLPAD 99 L C H F C+S W +Q+ TCP+C+ PAD Sbjct: 34 LRCGHNFCRGCVSRCWEVQVSPTCPVCKDRASPAD 68 >BC035053-1|AAH35053.1| 685|Homo sapiens ring finger protein 103 protein. Length = 685 Score = 33.1 bits (72), Expect = 1.1 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQ-LHATCPICR 78 L C H+FH +CI WL CP+CR Sbjct: 637 LPCGHVFHQNCIVMWLAGGRHCCPVCR 663 >BC018337-1|AAH18337.1| 206|Homo sapiens TRIM35 protein protein. Length = 206 Score = 33.1 bits (72), Expect = 1.1 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +1 Query: 1 LECEHLFHSSCISP-W-LQLHATCPICRRSLLPAD 99 L C H F C+S W +Q+ TCP+C+ PAD Sbjct: 34 LRCGHNFCRGCVSRCWEVQVSPTCPVCKDRASPAD 68 >AF492463-1|AAO85480.1| 493|Homo sapiens hemopoeitic lineage switch gene 5 protein. Length = 493 Score = 33.1 bits (72), Expect = 1.1 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +1 Query: 1 LECEHLFHSSCISP-W-LQLHATCPICRRSLLPAD 99 L C H F C+S W +Q+ TCP+C+ PAD Sbjct: 34 LRCGHNFCRGCVSRCWEVQVSPTCPVCKDRASPAD 68 >AC015971-1|AAX93079.1| 685|Homo sapiens unknown protein. Length = 685 Score = 33.1 bits (72), Expect = 1.1 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQ-LHATCPICR 78 L C H+FH +CI WL CP+CR Sbjct: 637 LPCGHVFHQNCIVMWLAGGRHCCPVCR 663 >AB052743-1|BAB20900.1| 685|Homo sapiens KF-1 protein protein. Length = 685 Score = 33.1 bits (72), Expect = 1.1 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQ-LHATCPICR 78 L C H+FH +CI WL CP+CR Sbjct: 637 LPCGHVFHQNCIVMWLAGGRHCCPVCR 663 >AB029021-1|BAA83050.1| 504|Homo sapiens KIAA1098 protein protein. Length = 504 Score = 33.1 bits (72), Expect = 1.1 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +1 Query: 1 LECEHLFHSSCISP-W-LQLHATCPICRRSLLPAD 99 L C H F C+S W +Q+ TCP+C+ PAD Sbjct: 45 LRCGHNFCRGCVSRCWEVQVSPTCPVCKDRASPAD 79 >CR533513-1|CAG38544.1| 362|Homo sapiens RNF32 protein. Length = 362 Score = 32.7 bits (71), Expect = 1.4 Identities = 11/30 (36%), Positives = 19/30 (63%), Gaps = 2/30 (6%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQL--HATCPICRRS 84 L C H+FH +C+ + + TCP+CR++ Sbjct: 142 LSCSHVFHKACLQAFEKFTNKKTCPLCRKN 171 >BT007037-1|AAP35686.1| 235|Homo sapiens ring finger protein 32 protein. Length = 235 Score = 32.7 bits (71), Expect = 1.4 Identities = 11/30 (36%), Positives = 19/30 (63%), Gaps = 2/30 (6%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQL--HATCPICRRS 84 L C H+FH +C+ + + TCP+CR++ Sbjct: 142 LSCSHVFHKACLQAFEKFTNKKTCPLCRKN 171 >BC028120-1|AAH28120.1| 256|Homo sapiens RNF32 protein protein. Length = 256 Score = 32.7 bits (71), Expect = 1.4 Identities = 11/30 (36%), Positives = 19/30 (63%), Gaps = 2/30 (6%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQL--HATCPICRRS 84 L C H+FH +C+ + + TCP+CR++ Sbjct: 142 LSCSHVFHKACLQAFEKFTNKKTCPLCRKN 171 >BC015416-1|AAH15416.1| 235|Homo sapiens RNF32 protein protein. Length = 235 Score = 32.7 bits (71), Expect = 1.4 Identities = 11/30 (36%), Positives = 19/30 (63%), Gaps = 2/30 (6%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQL--HATCPICRRS 84 L C H+FH +C+ + + TCP+CR++ Sbjct: 142 LSCSHVFHKACLQAFEKFTNKKTCPLCRKN 171 >AF441222-1|AAM18664.1| 362|Homo sapiens ring finger protein RNF32 protein. Length = 362 Score = 32.7 bits (71), Expect = 1.4 Identities = 11/30 (36%), Positives = 19/30 (63%), Gaps = 2/30 (6%) Frame = +1 Query: 1 LECEHLFHSSCISPWLQL--HATCPICRRS 84 L C H+FH +C+ + + TCP+CR++ Sbjct: 142 LSCSHVFHKACLQAFEKFTNKKTCPLCRKN 171 >U95140-1|AAC52022.1| 190|Homo sapiens RNF4 protein. Length = 190 Score = 32.3 bits (70), Expect = 1.9 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 4 ECEHLFHSSCISPWLQLHATCPICRRSL 87 EC H+F S C+ L+ TCP CR+ + Sbjct: 153 ECGHVFCSQCLRDSLKNANTCPTCRKKI 180 >BC107061-1|AAI07062.1| 242|Homo sapiens polycomb group ring finger 3 protein. Length = 242 Score = 32.3 bits (70), Expect = 1.9 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 4 ECEHLFHSSCISPWLQLHATCPICR 78 EC H F SC+ +L+ + TCP CR Sbjct: 32 ECLHTFCRSCLVKYLEENNTCPTCR 56 >BC031935-1|AAH31935.1| 190|Homo sapiens RNF4 protein protein. Length = 190 Score = 32.3 bits (70), Expect = 1.9 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 4 ECEHLFHSSCISPWLQLHATCPICRRSL 87 EC H+F S C+ L+ TCP CR+ + Sbjct: 153 ECGHVFCSQCLRDSLKNANTCPTCRKKI 180 >BC012072-1|AAH12072.1| 652|Homo sapiens CHFR protein protein. Length = 652 Score = 32.3 bits (70), Expect = 1.9 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICR 78 C H F ++C S W++ + CP CR Sbjct: 308 CMHTFCAACYSGWMERSSLCPTCR 331 >AK027687-1|BAB55297.1| 652|Homo sapiens protein ( Homo sapiens cDNA FLJ14781 fis, clone NT2RP4000455, weakly similar to TRANS-ACTING TRANSCRIPTIONAL PROTEIN ICP0. ). Length = 652 Score = 32.3 bits (70), Expect = 1.9 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICR 78 C H F ++C S W++ + CP CR Sbjct: 308 CMHTFCAACYSGWMERSSLCPTCR 331 >AK001658-1|BAA91817.1| 623|Homo sapiens protein ( Homo sapiens cDNA FLJ10796 fis, clone NT2RP4000648, weakly similar to TRANS-ACTING TRANSCRIPTIONAL PROTEIN ICP0. ). Length = 623 Score = 32.3 bits (70), Expect = 1.9 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICR 78 C H F ++C S W++ + CP CR Sbjct: 279 CMHTFCAACYSGWMERSSLCPTCR 302 >AJ001019-1|CAA04477.1| 247|Homo sapiens ring finger protein protein. Length = 247 Score = 32.3 bits (70), Expect = 1.9 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 4 ECEHLFHSSCISPWLQLHATCPICR 78 EC H F SC+ +L+ + TCP CR Sbjct: 37 ECLHTFCRSCLVKYLEENNTCPTCR 61 >AF170724-1|AAF91084.1| 664|Homo sapiens cell cycle checkpoint protein CHFR protein. Length = 664 Score = 32.3 bits (70), Expect = 1.9 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 Query: 7 CEHLFHSSCISPWLQLHATCPICR 78 C H F ++C S W++ + CP CR Sbjct: 320 CMHTFCAACYSGWMERSSLCPTCR 343 >AB000468-1|BAA19122.1| 190|Homo sapiens zinc finger protein protein. Length = 190 Score = 32.3 bits (70), Expect = 1.9 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 4 ECEHLFHSSCISPWLQLHATCPICRRSL 87 EC H+F S C+ L+ TCP CR+ + Sbjct: 153 ECGHVFCSQCLRDSLKNANTCPTCRKKI 180 >CR457298-1|CAG33579.1| 327|Homo sapiens RNF121 protein. Length = 327 Score = 31.9 bits (69), Expect = 2.5 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +1 Query: 1 LECEHLFHSSCISPW--LQLHATCPICRRSL 87 L C H+FH CI W + TCP C+ + Sbjct: 249 LSCNHVFHEFCIRGWCIVGKKQTCPYCKEKV 279 >BC117273-1|AAI17274.1| 317|Homo sapiens RNF121 protein protein. Length = 317 Score = 31.9 bits (69), Expect = 2.5 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +1 Query: 1 LECEHLFHSSCISPW--LQLHATCPICRRSL 87 L C H+FH CI W + TCP C+ + Sbjct: 239 LSCNHVFHEFCIRGWCIVGKKQTCPYCKEKV 269 >BC063680-1|AAH63680.1| 165|Homo sapiens RNF121 protein protein. Length = 165 Score = 31.9 bits (69), Expect = 2.5 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +1 Query: 1 LECEHLFHSSCISPW--LQLHATCPICRRSL 87 L C H+FH CI W + TCP C+ + Sbjct: 87 LSCNHVFHEFCIRGWCIVGKKQTCPYCKEKV 117 >BC034385-1|AAH34385.1| 328|Homo sapiens ring finger protein 175 protein. Length = 328 Score = 31.9 bits (69), Expect = 2.5 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +1 Query: 1 LECEHLFHSSCISPW--LQLHATCPICRRSL 87 L C H+FH CI W + TCP C+ + Sbjct: 250 LSCNHVFHEFCIRGWCIVGKKQTCPYCKEKV 280 >BC009672-1|AAH09672.2| 329|Homo sapiens RNF121 protein protein. Length = 329 Score = 31.9 bits (69), Expect = 2.5 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +1 Query: 1 LECEHLFHSSCISPW--LQLHATCPICRRSL 87 L C H+FH CI W + TCP C+ + Sbjct: 251 LSCNHVFHEFCIRGWCIVGKKQTCPYCKEKV 281 >BC004952-1|AAH04952.1| 247|Homo sapiens PCGF1 protein protein. Length = 247 Score = 31.9 bits (69), Expect = 2.5 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +1 Query: 4 ECEHLFHSSCISPWLQLHATCPICRRSLLPADP 102 EC H F SCI +LQ CP+C + P Sbjct: 50 ECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQP 82 >AK023139-1|BAB14423.1| 327|Homo sapiens 1,4-N-acetylglucosaminyltransferase IV. protein. Length = 327 Score = 31.9 bits (69), Expect = 2.5 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +1 Query: 1 LECEHLFHSSCISPW--LQLHATCPICRRSL 87 L C H+FH CI W + TCP C+ + Sbjct: 249 LSCNHVFHEFCIRGWCIVGKKQTCPYCKEKV 279 >AK001961-1|BAA92002.1| 152|Homo sapiens protein ( Homo sapiens cDNA FLJ11099 fis, clone PLACE1005530. ). Length = 152 Score = 31.9 bits (69), Expect = 2.5 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +1 Query: 1 LECEHLFHSSCISPW--LQLHATCPICRRSL 87 L C H+FH CI W + TCP C+ + Sbjct: 74 LSCNHVFHEFCIRGWCIVGKKQTCPYCKEKV 104 >AF087884-1|AAP97183.1| 238|Homo sapiens RNF3A-2 protein. Length = 238 Score = 31.9 bits (69), Expect = 2.5 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +1 Query: 4 ECEHLFHSSCISPWLQLHATCPICRRSLLPADP 102 EC H F SCI +LQ CP+C + P Sbjct: 41 ECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQP 73 >BX248580-7|CAM25899.1| 488|Homo sapiens tripartite motif-containing 39 protein. Length = 488 Score = 31.1 bits (67), Expect = 4.4 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = +1 Query: 1 LECEHLFHSSCISPW---LQLHATCPICRRS 84 +EC H F +CI+ W L+ CP+CR++ Sbjct: 42 IECGHNFCKACITRWWEDLERDFPCPVCRKT 72 >BX248580-6|CAM25900.1| 518|Homo sapiens tripartite motif-containing 39 protein. Length = 518 Score = 31.1 bits (67), Expect = 4.4 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = +1 Query: 1 LECEHLFHSSCISPW---LQLHATCPICRRS 84 +EC H F +CI+ W L+ CP+CR++ Sbjct: 42 IECGHNFCKACITRWWEDLERDFPCPVCRKT 72 >BX248580-5|CAM25898.1| 261|Homo sapiens tripartite motif-containing 39 protein. Length = 261 Score = 31.1 bits (67), Expect = 4.4 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = +1 Query: 1 LECEHLFHSSCISPW---LQLHATCPICRRS 84 +EC H F +CI+ W L+ CP+CR++ Sbjct: 42 IECGHNFCKACITRWWEDLERDFPCPVCRKT 72 >BX248580-4|CAM25897.1| 144|Homo sapiens tripartite motif-containing 39 protein. Length = 144 Score = 31.1 bits (67), Expect = 4.4 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = +1 Query: 1 LECEHLFHSSCISPW---LQLHATCPICRRS 84 +EC H F +CI+ W L+ CP+CR++ Sbjct: 42 IECGHNFCKACITRWWEDLERDFPCPVCRKT 72 >BX248580-3|CAM25896.1| 74|Homo sapiens tripartite motif-containing 39 protein. Length = 74 Score = 31.1 bits (67), Expect = 4.4 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = +1 Query: 1 LECEHLFHSSCISPW---LQLHATCPICRRS 84 +EC H F +CI+ W L+ CP+CR++ Sbjct: 42 IECGHNFCKACITRWWEDLERDFPCPVCRKT 72 >BT007370-1|AAP36034.1| 488|Homo sapiens tripartite motif-containing 39 protein. Length = 488 Score = 31.1 bits (67), Expect = 4.4 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = +1 Query: 1 LECEHLFHSSCISPW---LQLHATCPICRRS 84 +EC H F +CI+ W L+ CP+CR++ Sbjct: 42 IECGHNFCKACITRWWEDLERDFPCPVCRKT 72 >BC150284-1|AAI50285.1| 1766|Homo sapiens ZNF294 protein protein. Length = 1766 Score = 31.1 bits (67), Expect = 4.4 Identities = 11/28 (39%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = +1 Query: 7 CEHLFHSSCISPWL--QLHATCPICRRS 84 C+ FHS+C+ W +TCP+CR + Sbjct: 1737 CKKKFHSACLYKWFTSSNKSTCPLCRET 1764 >BC034985-1|AAH34985.1| 488|Homo sapiens tripartite motif-containing 39 protein. Length = 488 Score = 31.1 bits (67), Expect = 4.4 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = +1 Query: 1 LECEHLFHSSCISPW---LQLHATCPICRRS 84 +EC H F +CI+ W L+ CP+CR++ Sbjct: 42 IECGHNFCKACITRWWEDLERDFPCPVCRKT 72 >BC007661-1|AAH07661.1| 488|Homo sapiens TRIM39 protein protein. Length = 488 Score = 31.1 bits (67), Expect = 4.4 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = +1 Query: 1 LECEHLFHSSCISPW---LQLHATCPICRRS 84 +EC H F +CI+ W L+ CP+CR++ Sbjct: 42 IECGHNFCKACITRWWEDLERDFPCPVCRKT 72 >AL773535-7|CAI41818.1| 518|Homo sapiens tripartite motif-containing 39 protein. Length = 518 Score = 31.1 bits (67), Expect = 4.4 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = +1 Query: 1 LECEHLFHSSCISPW---LQLHATCPICRRS 84 +EC H F +CI+ W L+ CP+CR++ Sbjct: 42 IECGHNFCKACITRWWEDLERDFPCPVCRKT 72 >AL773535-6|CAI41819.1| 488|Homo sapiens tripartite motif-containing 39 protein. Length = 488 Score = 31.1 bits (67), Expect = 4.4 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = +1 Query: 1 LECEHLFHSSCISPW---LQLHATCPICRRS 84 +EC H F +CI+ W L+ CP+CR++ Sbjct: 42 IECGHNFCKACITRWWEDLERDFPCPVCRKT 72 >AL773535-5|CAM25728.1| 261|Homo sapiens tripartite motif-containing 39 protein. Length = 261 Score = 31.1 bits (67), Expect = 4.4 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = +1 Query: 1 LECEHLFHSSCISPW---LQLHATCPICRRS 84 +EC H F +CI+ W L+ CP+CR++ Sbjct: 42 IECGHNFCKACITRWWEDLERDFPCPVCRKT 72 >AL773535-4|CAM25727.1| 144|Homo sapiens tripartite motif-containing 39 protein. Length = 144 Score = 31.1 bits (67), Expect = 4.4 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = +1 Query: 1 LECEHLFHSSCISPW---LQLHATCPICRRS 84 +EC H F +CI+ W L+ CP+CR++ Sbjct: 42 IECGHNFCKACITRWWEDLERDFPCPVCRKT 72 >AL773535-3|CAM25726.1| 74|Homo sapiens tripartite motif-containing 39 protein. Length = 74 Score = 31.1 bits (67), Expect = 4.4 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = +1 Query: 1 LECEHLFHSSCISPW---LQLHATCPICRRS 84 +EC H F +CI+ W L+ CP+CR++ Sbjct: 42 IECGHNFCKACITRWWEDLERDFPCPVCRKT 72 >AL662832-13|CAI17502.1| 518|Homo sapiens tripartite motif-containing 39 protein. Length = 518 Score = 31.1 bits (67), Expect = 4.4 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = +1 Query: 1 LECEHLFHSSCISPW---LQLHATCPICRRS 84 +EC H F +CI+ W L+ CP+CR++ Sbjct: 42 IECGHNFCKACITRWWEDLERDFPCPVCRKT 72 >AL662832-12|CAI17501.1| 488|Homo sapiens tripartite motif-containing 39 protein. Length = 488 Score = 31.1 bits (67), Expect = 4.4 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = +1 Query: 1 LECEHLFHSSCISPW---LQLHATCPICRRS 84 +EC H F +CI+ W L+ CP+CR++ Sbjct: 42 IECGHNFCKACITRWWEDLERDFPCPVCRKT 72 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,726,850 Number of Sequences: 237096 Number of extensions: 1106079 Number of successful extensions: 3491 Number of sequences better than 10.0: 285 Number of HSP's better than 10.0 without gapping: 3224 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3486 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8903143626 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -