BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0081.Seq (673 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5829| Best HMM Match : S4 (HMM E-Value=4.2) 29 3.4 SB_40163| Best HMM Match : TGS (HMM E-Value=2.8) 29 4.5 >SB_5829| Best HMM Match : S4 (HMM E-Value=4.2) Length = 893 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Frame = -2 Query: 459 ISICLEIRNLNNLISLTMTS---MFTSALSYITIPLRERDKTSSIPTKNF 319 I +C+ R L+ I L+ T+ ++ L Y+ +P+++ D P +NF Sbjct: 131 IRVCMYYRMLDVHIGLSQTTFKGLYNKGLVYLIVPIKDEDYIIVPPLENF 180 >SB_40163| Best HMM Match : TGS (HMM E-Value=2.8) Length = 642 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -1 Query: 409 NDVNVHERFKLYNNPIEGKRQNIVHPHEKLQTPKSRKK 296 ND +HER L + G+ QNIV+ + +P ++K Sbjct: 497 ND-QIHERSSLVRQILSGQGQNIVNVRDSRSSPNRKRK 533 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,466,950 Number of Sequences: 59808 Number of extensions: 296395 Number of successful extensions: 630 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 605 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 630 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1721264831 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -