BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0074.Seq (735 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222289-1|ABN79649.1| 68|Tribolium castaneum adipokinetic hor... 22 4.5 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 22 4.5 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 22 4.5 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 22 4.5 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 22 5.9 >EF222289-1|ABN79649.1| 68|Tribolium castaneum adipokinetic hormone 2 protein. Length = 68 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -1 Query: 633 LCQAYLNFGSNW 598 LC A LNF NW Sbjct: 16 LCAAQLNFTPNW 27 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +3 Query: 507 PHPVPHLPLFIDLSHKKSIQYRTTNFVPPS 596 P P P LP + + K+++ T +PP+ Sbjct: 188 PQPQPVLPTYKWMQVKRNVPKPTVPKIPPA 217 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 657 GVTCGGKTTLANKLKNALTPV 719 G TCGG ++ LK+A PV Sbjct: 21 GSTCGGSSSSMAYLKSAPYPV 41 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +3 Query: 507 PHPVPHLPLFIDLSHKKSIQYRTTNFVPPS 596 P P P LP + + K+++ T +PP+ Sbjct: 188 PQPQPVLPTYKWMQVKRNVPKPTVPKIPPA 217 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -1 Query: 261 GQLIIISCVVRFFTSTFVW 205 G +III C+++F T F + Sbjct: 535 GFIIIIGCLIQFNTIVFAF 553 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,582 Number of Sequences: 336 Number of extensions: 3791 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19675845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -