BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0069.Seq (770 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1683.09c |frp1||ferric-chelate reductase Frp1|Schizosaccharo... 27 2.2 SPAC8C9.06c |||mitochondrial translation regulator |Schizosaccha... 27 3.9 >SPBC1683.09c |frp1||ferric-chelate reductase Frp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 564 Score = 27.5 bits (58), Expect = 2.2 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = -3 Query: 354 HNPSNRRYFLFTIYFLYV--LYIRICIHIIVLNLI 256 H+PS++R Y+L+V +Y + H ++L LI Sbjct: 44 HDPSDKRQIWLEKYYLFVRQIYTYLVTHKVILTLI 78 >SPAC8C9.06c |||mitochondrial translation regulator |Schizosaccharomyces pombe|chr 1|||Manual Length = 931 Score = 26.6 bits (56), Expect = 3.9 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -3 Query: 159 YFFSSSWASFGTQTSRLKVYMCSGRRL-RVRKHKNGLGFNKFILH 28 Y FSS F ++SR Y CS + +V +H N LG ++++LH Sbjct: 153 YLFSSY---FSYKSSRQ--YTCSSEEISKVFRHLNRLGGSEYVLH 192 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,740,058 Number of Sequences: 5004 Number of extensions: 50499 Number of successful extensions: 91 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 91 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 371330890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -