BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0069.Seq (770 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_02_0046 + 10928708-10928798,10929997-10930077,10930567-109306... 28 7.2 01_05_0769 - 25042022-25042447,25042856-25043234,25043714-250437... 28 9.5 >06_02_0046 + 10928708-10928798,10929997-10930077,10930567-10930685, 10931275-10931894,10931992-10933184,10933280-10933359, 10933751-10933846,10933931-10934004,10936007-10936151, 10936323-10936487 Length = 887 Score = 28.3 bits (60), Expect = 7.2 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = -3 Query: 183 YIDASNLIYFFSSS--WASFGTQTSRLKVYMCSGRRLRVRKHKNG 55 Y+D +NL+Y +A+ GT+ + YM + V+ H+NG Sbjct: 535 YVDQANLVYTVPGMEYYAAAGTEGTHASYYMQTSEPHVVQAHQNG 579 >01_05_0769 - 25042022-25042447,25042856-25043234,25043714-25043763, 25044222-25044442,25045085-25045385 Length = 458 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -1 Query: 233 RNYKKVKVEYVDFPEQITLMLQI*FI 156 R YK++++ + +P ++TLML I FI Sbjct: 338 RTYKEMELGGIKYPAEVTLMLPILFI 363 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,533,278 Number of Sequences: 37544 Number of extensions: 257727 Number of successful extensions: 397 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 387 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 397 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2075009728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -