BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0069.Seq (770 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g40900.1 68415.m05047 nodulin MtN21 family protein similar to... 29 4.5 At3g27900.1 68416.m03481 hypothetical protein 28 7.9 >At2g40900.1 68415.m05047 nodulin MtN21 family protein similar to MtN21 [Medicago truncatula] GI:2598575; contains Pfam profile PF00892: Integral membrane protein Length = 394 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -3 Query: 195 PRADYIDASNLIYFFSSSWASFGT-QTSRLKVY 100 P ADY+ A+ + S SWASF Q + LK Y Sbjct: 173 PTADYLKAAVFLLLASLSWASFFVLQAATLKKY 205 >At3g27900.1 68416.m03481 hypothetical protein Length = 244 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +2 Query: 236 NG*RKSVIKLSTIMCIHIRIYNTYKKYIVNRKYRRLD 346 NG + VIK S I+C+ ++ T + ++N K R LD Sbjct: 186 NGFAREVIK-SNILCLWKSLFETSQPKVINLKNRTLD 221 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,459,972 Number of Sequences: 28952 Number of extensions: 234562 Number of successful extensions: 382 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 382 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1716774400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -