BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0066.Seq (764 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 22 6.2 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 22 6.2 AJ850292-1|CAH64512.1| 539|Tribolium castaneum putative esteras... 21 8.2 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.8 bits (44), Expect = 6.2 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -1 Query: 536 CLKFR*NFVCFVFVYMAFVFLIPLL 462 C K R + +C + ++A +F P+L Sbjct: 182 CTKTRASLICLLAWFIAALFTSPIL 206 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.8 bits (44), Expect = 6.2 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -1 Query: 536 CLKFR*NFVCFVFVYMAFVFLIPLL 462 C K R + +C + ++A +F P+L Sbjct: 182 CTKTRASLICLLAWFIAALFTSPML 206 >AJ850292-1|CAH64512.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = +3 Query: 54 YLFYPSFNPITGIYAIVKQLCIHDYVLL*SKKI 152 YL + F P+ +A L H Y ++ +K++ Sbjct: 278 YLPFAQFGPVIDSWATQPVLPTHPYQIIKNKQV 310 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,999 Number of Sequences: 336 Number of extensions: 4127 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20546262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -