BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0066.Seq (764 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF014939-1|AAB63926.1| 578|Caenorhabditis elegans Hypothetical ... 30 1.6 AC024788-4|ABE73331.1| 305|Caenorhabditis elegans Hypothetical ... 29 2.7 >AF014939-1|AAB63926.1| 578|Caenorhabditis elegans Hypothetical protein ZC132.3a protein. Length = 578 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 4/52 (7%) Frame = -1 Query: 536 CLKFR*NFVCFVFVYMAFV----FLIPLLEFIFKKFCEIMNRHIDFTKTEVS 393 CL NF+ + + FV FL+P + IF+ FC +H++F + E++ Sbjct: 525 CLFVAGNFINYEIIISMFVTSDLFLVPSMVLIFEVFCR--PKHVEFQEVEMT 574 >AC024788-4|ABE73331.1| 305|Caenorhabditis elegans Hypothetical protein Y46E12A.4 protein. Length = 305 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -1 Query: 476 LIPLLEFIFKKFCEIMNRHIDFTKTEVS 393 L P+LEF FK CE +N I T +S Sbjct: 32 LFPILEFAFKGLCEHLNYKIGVTMEPIS 59 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,365,041 Number of Sequences: 27780 Number of extensions: 342608 Number of successful extensions: 683 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 664 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 683 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1830096852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -