BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0066.Seq (764 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g26650.1 68414.m03245 expressed protein 29 3.4 At5g55960.1 68418.m06979 expressed protein 28 5.9 >At1g26650.1 68414.m03245 expressed protein Length = 335 Score = 29.1 bits (62), Expect = 3.4 Identities = 19/70 (27%), Positives = 32/70 (45%), Gaps = 4/70 (5%) Frame = -3 Query: 678 FPSFVTVILLSK-AFVYFIEYEFLNAI*AFLSYIKIISPYWALLENLIVFEI*IE---FC 511 FP F+TV LLSK A VY ++ + + ++ I+ W + V+ + F Sbjct: 111 FPVFITVSLLSKAAVVYSVDCSYSREVVDISKFLVILQKIWRRVVFTYVWICILIVGCFT 170 Query: 510 LFCIRIHGFC 481 FC+ + C Sbjct: 171 FFCVLLVAIC 180 >At5g55960.1 68418.m06979 expressed protein Length = 648 Score = 28.3 bits (60), Expect = 5.9 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = -3 Query: 723 LVIKGTLLYLHKRVKFPSFVTVILLSKAFVYFIEYEFLNAI*AFLSYIKIISPYW 559 L I G LL + F +T +L +Y I + +++ + AF+S + I PYW Sbjct: 501 LAISGVLLATAEIAFFQGCLTWLLFR---LYNIHFLYMSTVLAFISALLPIFPYW 552 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,708,724 Number of Sequences: 28952 Number of extensions: 283995 Number of successful extensions: 464 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 460 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 464 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1712086600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -