Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= pg--0062.Seq
         (742 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK056023-1|BAB71075.1|  136|Homo sapiens protein ( Homo sapiens ...    36   0.12 

>AK056023-1|BAB71075.1|  136|Homo sapiens protein ( Homo sapiens
           cDNA FLJ31461 fis, clone NT2NE2001247. ).
          Length = 136

 Score = 36.3 bits (80), Expect = 0.12
 Identities = 24/69 (34%), Positives = 36/69 (52%), Gaps = 4/69 (5%)
 Frame = -2

Query: 399 LNTVVSVQLCSAQLLAGTSETHLMFVRLYNLISLL--IQFCI--YISMSLS*FKSIEYTH 232
           L+  + +Q  S  L    S++  +F  +   +SLL  I  C+  Y+S+SLS F     TH
Sbjct: 17  LHIFLLLQKISVSLPLSLSQSVCLFYSISLCVSLLLHISLCVSVYVSLSLSSFPCFSLTH 76

Query: 231 THTTSM*NK 205
           THT S  +K
Sbjct: 77  THTHSQLSK 85


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 86,135,474
Number of Sequences: 237096
Number of extensions: 1447365
Number of successful extensions: 1821
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1800
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1818
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8847149012
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)