BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= pg--0062.Seq
(742 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AK056023-1|BAB71075.1| 136|Homo sapiens protein ( Homo sapiens ... 36 0.12
>AK056023-1|BAB71075.1| 136|Homo sapiens protein ( Homo sapiens
cDNA FLJ31461 fis, clone NT2NE2001247. ).
Length = 136
Score = 36.3 bits (80), Expect = 0.12
Identities = 24/69 (34%), Positives = 36/69 (52%), Gaps = 4/69 (5%)
Frame = -2
Query: 399 LNTVVSVQLCSAQLLAGTSETHLMFVRLYNLISLL--IQFCI--YISMSLS*FKSIEYTH 232
L+ + +Q S L S++ +F + +SLL I C+ Y+S+SLS F TH
Sbjct: 17 LHIFLLLQKISVSLPLSLSQSVCLFYSISLCVSLLLHISLCVSVYVSLSLSSFPCFSLTH 76
Query: 231 THTTSM*NK 205
THT S +K
Sbjct: 77 THTHSQLSK 85
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 86,135,474
Number of Sequences: 237096
Number of extensions: 1447365
Number of successful extensions: 1821
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1800
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1818
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8847149012
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -