BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0062.Seq (742 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g04540.1 68415.m00460 3-oxoacyl-[acyl-carrier-protein] syntha... 27 9.9 At1g53350.1 68414.m06048 disease resistance protein (CC-NBS-LRR ... 27 9.9 At1g23180.1 68414.m02896 armadillo/beta-catenin repeat family pr... 27 9.9 >At2g04540.1 68415.m00460 3-oxoacyl-[acyl-carrier-protein] synthase II, putative similar to Swiss-Prot:P56902 3-oxoacyl-[acyl-carrier-protein] synthase II (EC 2.3.1.41) (Beta- ketoacyl-ACP synthase II) (KAS II) [Rhizobium meliloti] Length = 461 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 465 LRAH*SVARIIINNLIMTKNKYNSH 539 LR H S +R+ +N I T + Y+SH Sbjct: 6 LRRHLSASRLRLNRFISTSSSYHSH 30 >At1g53350.1 68414.m06048 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 906 Score = 27.5 bits (58), Expect = 9.9 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -1 Query: 151 KDTKFIRTVRQTKIPSTTYNNKKKITLRNLLLHF--ALHV 38 K+ FIR V+ STT N + R L+LH ALH+ Sbjct: 504 KEENFIRVVKVPTTTSTTINAQSPCRSRRLVLHSGNALHM 543 >At1g23180.1 68414.m02896 armadillo/beta-catenin repeat family protein contains Pfam profile: PF00514 armadillo/beta-catenin-like repeat Length = 834 Score = 27.5 bits (58), Expect = 9.9 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +3 Query: 543 KGG*SVI*KLLVLQNRSCI**NITILYQT*HDSESH 650 +GG + KLL +N C+ ++++LY DSE+H Sbjct: 764 QGGIEPLVKLLEERNERCVEASLSVLYNLTMDSENH 799 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,023,353 Number of Sequences: 28952 Number of extensions: 230847 Number of successful extensions: 409 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 401 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 409 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1633819784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -