BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0060.Seq (788 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY226548-1|AAO47374.1| 404|Drosophila melanogaster pickpocket 2... 29 9.6 AE014297-4405|AAF56910.2| 587|Drosophila melanogaster CG7577-PA... 29 9.6 >AY226548-1|AAO47374.1| 404|Drosophila melanogaster pickpocket 20 protein. Length = 404 Score = 28.7 bits (61), Expect = 9.6 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 175 NFRCISQIIDVSFPGSFCVRYVLLCIRYPEDS 270 N RC++ ++ V F S+C + + C+RY DS Sbjct: 19 NERCLADLLKVHFR-SYCEKSTIHCVRYLYDS 49 >AE014297-4405|AAF56910.2| 587|Drosophila melanogaster CG7577-PA protein. Length = 587 Score = 28.7 bits (61), Expect = 9.6 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 175 NFRCISQIIDVSFPGSFCVRYVLLCIRYPEDS 270 N RC++ ++ V F S+C + + C+RY DS Sbjct: 19 NERCLADLLKVHFR-SYCEKSTIHCVRYLYDS 49 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,883,517 Number of Sequences: 53049 Number of extensions: 548124 Number of successful extensions: 832 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 816 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 832 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3654740856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -