BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0050.Seq (761 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 29 3.1 SB_42132| Best HMM Match : DAGK_cat (HMM E-Value=1.3e-35) 29 5.5 SB_31609| Best HMM Match : Peptidase_M16_C (HMM E-Value=5.7e-08) 28 7.2 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +2 Query: 188 MYKNVKPILSTKVSQWSFSTLLNDIEGFSPK*NPK 292 M KNVK + +V++W+F + D+E NP+ Sbjct: 1136 MLKNVKKVSEREVTKWAFISSPEDLESLVSNLNPR 1170 >SB_42132| Best HMM Match : DAGK_cat (HMM E-Value=1.3e-35) Length = 558 Score = 28.7 bits (61), Expect = 5.5 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 147 GFRSESCIEQIHDECIKT*NLFYPQKCL 230 G E+C +HDEC++T N + K L Sbjct: 166 GLHCENCTLSVHDECLETANEVFTCKAL 193 >SB_31609| Best HMM Match : Peptidase_M16_C (HMM E-Value=5.7e-08) Length = 456 Score = 28.3 bits (60), Expect = 7.2 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -3 Query: 252 NNVENDH*DTFVDKIGFTFLYIH 184 + +END DTF D + + FLY H Sbjct: 245 DKIENDPHDTFADLVIYDFLYSH 267 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,721,518 Number of Sequences: 59808 Number of extensions: 360046 Number of successful extensions: 535 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 510 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 533 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2082369341 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -