BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0042.Seq (626 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) 48 8e-06 SB_52731| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 48 8e-06 SB_46156| Best HMM Match : RNA_pol_delta (HMM E-Value=8.9) 48 8e-06 SB_45235| Best HMM Match : CBM_20 (HMM E-Value=0.91) 48 8e-06 SB_43774| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.21) 48 8e-06 SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) 48 8e-06 SB_31470| Best HMM Match : SAND (HMM E-Value=5e-37) 48 8e-06 SB_30809| Best HMM Match : Mab-21 (HMM E-Value=0) 48 8e-06 SB_28657| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_26361| Best HMM Match : fn3 (HMM E-Value=0) 48 8e-06 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 48 8e-06 SB_25307| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_23523| Best HMM Match : LRR_1 (HMM E-Value=0.00074) 48 8e-06 SB_20950| Best HMM Match : PHD (HMM E-Value=0.2) 48 8e-06 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 48 8e-06 SB_18129| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_15061| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_13351| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_13245| Best HMM Match : Ion_trans (HMM E-Value=3.3e-25) 48 8e-06 SB_13077| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_12242| Best HMM Match : RGS (HMM E-Value=0.75) 48 8e-06 SB_5662| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_3686| Best HMM Match : Myotub-related (HMM E-Value=2.8e-08) 48 8e-06 SB_56167| Best HMM Match : Plasmodium_HRP (HMM E-Value=6.8) 48 8e-06 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_55413| Best HMM Match : LRR_1 (HMM E-Value=0.00077) 48 8e-06 SB_55031| Best HMM Match : GRP (HMM E-Value=5.3) 48 8e-06 SB_52825| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_47281| Best HMM Match : Adaptin_N (HMM E-Value=0) 48 8e-06 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_39908| Best HMM Match : Prismane (HMM E-Value=3) 48 8e-06 SB_31266| Best HMM Match : PKI (HMM E-Value=1) 48 8e-06 SB_28964| Best HMM Match : Kinesin (HMM E-Value=2.4e-05) 48 8e-06 SB_26019| Best HMM Match : F5_F8_type_C (HMM E-Value=2.6e-29) 48 8e-06 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 48 8e-06 SB_24420| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_21827| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_19785| Best HMM Match : SRR1 (HMM E-Value=8.8e-19) 48 8e-06 SB_19262| Best HMM Match : Laminin_EGF (HMM E-Value=0.36) 48 8e-06 SB_14096| Best HMM Match : DUF595 (HMM E-Value=2.1) 48 8e-06 SB_13740| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_12193| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 48 8e-06 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 48 8e-06 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_9189| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) 46 3e-05 SB_15919| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_37409| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_9761| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_59099| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_59056| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_59022| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.4e-13) 41 7e-04 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_58938| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_58787| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_58740| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_58322| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 41 7e-04 SB_58087| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_57919| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_57765| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 41 7e-04 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 41 7e-04 SB_57517| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_57244| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_57238| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 41 7e-04 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56899| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56712| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 41 7e-04 SB_56631| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 41 7e-04 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_55775| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_55207| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_55081| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_54479| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 41 7e-04 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 41 7e-04 SB_54117| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_54116| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_54092| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 41 7e-04 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 41 7e-04 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_53629| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_53123| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_52872| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_52828| Best HMM Match : Apidaecin (HMM E-Value=4.5) 41 7e-04 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 41 7e-04 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_52419| Best HMM Match : Drf_DAD (HMM E-Value=2.5) 41 7e-04 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 41 7e-04 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_51754| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 41 7e-04 SB_51567| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 41 7e-04 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_51356| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_51272| Best HMM Match : SMC_hinge (HMM E-Value=6.3) 41 7e-04 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 41 7e-04 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_51070| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_50749| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 41 7e-04 SB_50634| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_50512| Best HMM Match : Kelch_1 (HMM E-Value=0.17) 41 7e-04 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_50488| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_50482| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_50012| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_49975| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_49917| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_49901| Best HMM Match : DoxX (HMM E-Value=6.2) 41 7e-04 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_49761| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_49678| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_49547| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_49509| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_49332| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 41 7e-04 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 41 7e-04 SB_48922| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_48921| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_48874| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_48840| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_48531| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_48210| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) 41 7e-04 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 41 7e-04 SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_47936| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_47873| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_47842| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_47650| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_47060| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_46943| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_46899| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 41 7e-04 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_46559| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 41 7e-04 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_46255| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_46237| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_46079| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_45828| Best HMM Match : S-antigen (HMM E-Value=0.0095) 41 7e-04 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_45770| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_45428| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_45376| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_45360| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_45128| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_44882| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 41 7e-04 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 41 7e-04 SB_44716| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_44551| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 41 7e-04 SB_44121| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 41 7e-04 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_43812| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) 41 7e-04 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 41 7e-04 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_43415| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_43235| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 41 7e-04 SB_43116| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 41 7e-04 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 41 7e-04 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_42166| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_42148| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 41 7e-04 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_41652| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_41597| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_41534| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_41390| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_40755| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_40748| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_40671| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_40647| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_40555| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_40354| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_39915| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_39901| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_39749| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_39688| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_39619| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_39535| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_39117| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 41 7e-04 SB_39027| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_38970| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 41 7e-04 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 41 7e-04 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 41 7e-04 SB_38657| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_38472| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_38131| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_38069| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_38008| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 41 7e-04 SB_37882| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_37739| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_37640| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_37631| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_37441| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_37438| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_37176| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_37098| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 41 7e-04 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_36766| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_36634| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_36591| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_36255| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_36142| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_36100| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_35967| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_35870| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_35723| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_35236| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_35015| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_34995| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_34882| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_34723| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 41 7e-04 SB_34164| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_34076| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_33847| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_33842| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_33832| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_33796| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 41 7e-04 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_33225| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_32681| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_32569| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 41 7e-04 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 41 7e-04 SB_32505| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 41 7e-04 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_32290| Best HMM Match : BTP (HMM E-Value=8.7) 41 7e-04 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 >SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) Length = 857 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 603 SVAVTLRVTTTPAALNAPLQGASHSPF 629 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 626 HSPFRLRNCWEGR 638 >SB_52731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 20 SVAVTLRVTTTPAALNAPLQGASHSPF 46 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 43 HSPFRLRNCWEGR 55 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 381 SVAVTLRVTTTPAALNAPLQGASHSPF 407 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 404 HSPFRLRNCWEGR 416 Score = 30.7 bits (66), Expect = 1.0 Identities = 11/16 (68%), Positives = 15/16 (93%) Frame = +2 Query: 2 RPSQQLRTSNGEWQIV 49 RPSQQLR+ NGEW+++ Sbjct: 1229 RPSQQLRSLNGEWRLM 1244 >SB_46156| Best HMM Match : RNA_pol_delta (HMM E-Value=8.9) Length = 138 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_45235| Best HMM Match : CBM_20 (HMM E-Value=0.91) Length = 817 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 612 SVAVTLRVTTTPAALNAPLQGASHSPF 638 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 635 HSPFRLRNCWEGR 647 >SB_43774| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.21) Length = 429 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 681 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 480 SVAVTLRVTTTPAALNAPLQGASHSPF 506 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 503 HSPFRLRNCWEGR 515 >SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) Length = 141 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 20 SVAVTLRVTTTPAALNAPLQGASHSPF 46 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 43 HSPFRLRNCWEGR 55 >SB_31470| Best HMM Match : SAND (HMM E-Value=5e-37) Length = 912 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_30809| Best HMM Match : Mab-21 (HMM E-Value=0) Length = 1710 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 746 SVAVTLRVTTTPAALNAPLQGASHSPF 772 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 769 HSPFRLRNCWEGR 781 >SB_28657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3296 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 2367 SVAVTLRVTTTPAALNAPLQGASHSPF 2393 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 2390 HSPFRLRNCWEGR 2402 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 20 SVAVTLRVTTTPAALNAPLQGASHSPF 46 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 43 HSPFRLRNCWEGR 55 >SB_26361| Best HMM Match : fn3 (HMM E-Value=0) Length = 1898 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 566 SVAVTLRVTTTPAALNAPLQGASHSPF 592 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 589 HSPFRLRNCWEGR 601 >SB_25307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 18 SVAVTLRVTTTPAALNAPLQGASHSPF 44 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 41 HSPFRLRNCWEGR 53 >SB_23523| Best HMM Match : LRR_1 (HMM E-Value=0.00074) Length = 615 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 240 SVAVTLRVTTTPAALNAPLQGASHSPF 266 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 263 HSPFRLRNCWEGR 275 >SB_20950| Best HMM Match : PHD (HMM E-Value=0.2) Length = 298 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 143 SVAVTLRVTTTPAALNAPLQGASHSPF 169 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 166 HSPFRLRNCWEGR 178 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_18129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 367 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_15061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 544 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 36 SVAVTLRVTTTPAALNAPLQGASHSPF 62 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 59 HSPFRLRNCWEGR 71 >SB_13351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 501 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_13245| Best HMM Match : Ion_trans (HMM E-Value=3.3e-25) Length = 816 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 38 SVAVTLRVTTTPAALNAPLQGASHSPF 64 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 61 HSPFRLRNCWEGR 73 >SB_13077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 31.5 bits (68), Expect = 0.58 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 39 HSPFEVRNCWEG 4 HSPF +RNCWEG Sbjct: 32 HSPFRLRNCWEG 43 >SB_12242| Best HMM Match : RGS (HMM E-Value=0.75) Length = 737 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 121 SVAVTLRVTTTPAALNAPLQGASHSPF 147 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 144 HSPFRLRNCWEGR 156 >SB_5662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 27.5 bits (58), Expect = 9.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -3 Query: 39 HSPFEVRNCWE 7 HSPF +RNCW+ Sbjct: 32 HSPFRLRNCWK 42 >SB_3686| Best HMM Match : Myotub-related (HMM E-Value=2.8e-08) Length = 629 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_56167| Best HMM Match : Plasmodium_HRP (HMM E-Value=6.8) Length = 285 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 596 SVAVTLRVTTTPAALNAPLQGASHSPF 622 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 619 HSPFRLRNCWEGR 631 >SB_55413| Best HMM Match : LRR_1 (HMM E-Value=0.00077) Length = 359 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_55031| Best HMM Match : GRP (HMM E-Value=5.3) Length = 487 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_52825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1141 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 430 SVAVTLRVTTTPAALNAPLQGASHSPF 456 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 453 HSPFRLRNCWEGR 465 >SB_47281| Best HMM Match : Adaptin_N (HMM E-Value=0) Length = 949 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 48 SVAVTLRVTTTPAALNAPLQGASHSPF 74 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 71 HSPFRLRNCWEGR 83 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 395 HSPFRLRNCWEGR 407 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 107 SVAVTLRVTTTPAALNAPLQGASHSPF 133 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 130 HSPFRLRNCWEGR 142 >SB_39908| Best HMM Match : Prismane (HMM E-Value=3) Length = 456 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 298 SVAVTLRVTTTPAALNAPLQGASHSPF 324 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 321 HSPFRLRNCWEGR 333 >SB_31266| Best HMM Match : PKI (HMM E-Value=1) Length = 1507 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_28964| Best HMM Match : Kinesin (HMM E-Value=2.4e-05) Length = 296 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 42 SVAVTLRVTTTPAALNAPLQGASHSPF 68 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 65 HSPFRLRNCWEGR 77 >SB_26019| Best HMM Match : F5_F8_type_C (HMM E-Value=2.6e-29) Length = 438 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 163 SVAVTLRVTTTPAALNAPLQGASHSPF 189 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 186 HSPFRLRNCWEGR 198 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 558 SVAVTLRVTTTPAALNAPLQGASHSPF 584 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 581 HSPFRLRNCWEGR 593 >SB_24420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 608 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 51 SVAVTLRVTTTPAALNAPLQGASHSPF 77 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 74 HSPFRLRNCWEGR 86 >SB_21827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 708 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 321 SVAVTLRVTTTPAALNAPLQGASHSPF 347 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 344 HSPFRLRNCWEGR 356 >SB_19785| Best HMM Match : SRR1 (HMM E-Value=8.8e-19) Length = 735 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 356 SVAVTLRVTTTPAALNAPLQGASHSPF 382 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 379 HSPFRLRNCWEGR 391 >SB_19262| Best HMM Match : Laminin_EGF (HMM E-Value=0.36) Length = 1173 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 49 SVAVTLRVTTTPAALNAPLQGASHSPF 75 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 72 HSPFRLRNCWEGR 84 >SB_14096| Best HMM Match : DUF595 (HMM E-Value=2.1) Length = 233 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_13740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 430 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_12193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 457 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 184 SVAVTLRVTTTPAALNAPLQGASHSPF 210 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 207 HSPFRLRNCWEGR 219 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 46.0 bits (104), Expect = 3e-05 Identities = 17/19 (89%), Positives = 19/19 (100%) Frame = -3 Query: 477 IKRGGCGGYAQRERYTCQR 421 +KRGGCGGYAQR+RYTCQR Sbjct: 88 LKRGGCGGYAQRDRYTCQR 106 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_9189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 46.0 bits (104), Expect = 3e-05 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SV +TLRVTTTPAALNAPLQGAS F Sbjct: 9 SVTVTLRVTTTPAALNAPLQGASHSPF 35 >SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) Length = 181 Score = 46.0 bits (104), Expect = 3e-05 Identities = 17/19 (89%), Positives = 19/19 (100%) Frame = -3 Query: 477 IKRGGCGGYAQRERYTCQR 421 +KRGGCGGYAQR+RYTCQR Sbjct: 163 LKRGGCGGYAQRDRYTCQR 181 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 143 RPSQQLRSLNGEW 155 >SB_15919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 44.4 bits (100), Expect = 8e-05 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVALTLRVTTTPAALNAPLQGASGGTF 510 SVA+TLRVTTTPAAL APLQGAS F Sbjct: 20 SVAVTLRVTTTPAALYAPLQGASHSPF 46 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFEVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 43 HSPFRLRNCWEGR 55 >SB_37409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 42.7 bits (96), Expect = 2e-04 Identities = 24/34 (70%), Positives = 26/34 (76%), Gaps = 1/34 (2%) Frame = -1 Query: 539 TNRGSAHI-SPKVPPDAPCSGALSAAGVVVTRSV 441 T+R S H+ S DAPCSGALSAAGVVVTRSV Sbjct: 16 TDRPSQHLRSLNGEWDAPCSGALSAAGVVVTRSV 49 >SB_9761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 34 Score = 41.9 bits (94), Expect = 4e-04 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = -3 Query: 513 PESAT*RAL*RRIKRGGCGGYAQRERYTCQ 424 PE R+L RRIK G GGYAQR+RYTCQ Sbjct: 4 PEWPMGRSLYRRIKPVGSGGYAQRDRYTCQ 33 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 87 DAPCSGALSAAGVVVTRSV 105 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 74 RPSQQLRSLNGEW 86 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 96 DAPCSGALSAAGVVVTRSV 114 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 83 RPSQQLRSLNGEW 95 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 88 DAPCSGALSAAGVVVTRSV 106 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 75 RPSQQLRSLNGEW 87 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 114 DAPCSGALSAAGVVVTRSV 132 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 101 RPSQQLRSLNGEW 113 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 94 DAPCSGALSAAGVVVTRSV 112 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 81 RPSQQLRSLNGEW 93 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 119 DAPCSGALSAAGVVVTRSV 137 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 106 RPSQQLRSLNGEW 118 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 90 DAPCSGALSAAGVVVTRSV 108 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 77 RPSQQLRSLNGEW 89 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 110 DAPCSGALSAAGVVVTRSV 128 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 97 RPSQQLRSLNGEW 109 >SB_59099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_59056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_59022| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.4e-13) Length = 751 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 529 DAPCSGALSAAGVVVTRSV 547 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 516 RPSQQLRSLNGEW 528 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 122 DAPCSGALSAAGVVVTRSV 140 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 109 RPSQQLRSLNGEW 121 >SB_58938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 60 DAPCSGALSAAGVVVTRSV 78 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 47 RPSQQLRSLNGEW 59 >SB_58787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 98 DAPCSGALSAAGVVVTRSV 116 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 85 RPSQQLRSLNGEW 97 >SB_58740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 87 DAPCSGALSAAGVVVTRSV 105 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 74 RPSQQLRSLNGEW 86 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 102 DAPCSGALSAAGVVVTRSV 120 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 89 RPSQQLRSLNGEW 101 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 111 DAPCSGALSAAGVVVTRSV 129 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 98 RPSQQLRSLNGEW 110 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 105 DAPCSGALSAAGVVVTRSV 123 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 92 RPSQQLRSLNGEW 104 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 121 DAPCSGALSAAGVVVTRSV 139 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 108 RPSQQLRSLNGEW 120 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 109 DAPCSGALSAAGVVVTRSV 127 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 96 RPSQQLRSLNGEW 108 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 92 DAPCSGALSAAGVVVTRSV 110 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 79 RPSQQLRSLNGEW 91 >SB_58322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 268 DAPCSGALSAAGVVVTRSV 286 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 255 RPSQQLRSLNGEW 267 >SB_58087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 163 DAPCSGALSAAGVVVTRSV 181 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 150 RPSQQLRSLNGEW 162 >SB_57919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 99 DAPCSGALSAAGVVVTRSV 117 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 86 RPSQQLRSLNGEW 98 >SB_57765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 433 DAPCSGALSAAGVVVTRSV 451 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 420 RPSQQLRSLNGEW 432 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 159 DAPCSGALSAAGVVVTRSV 177 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 146 RPSQQLRSLNGEW 158 >SB_57517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 135 DAPCSGALSAAGVVVTRSV 153 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 122 RPSQQLRSLNGEW 134 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 91 DAPCSGALSAAGVVVTRSV 109 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 78 RPSQQLRSLNGEW 90 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 60 DAPCSGALSAAGVVVTRSV 78 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 47 RPSQQLRSLNGEW 59 >SB_57244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_57238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 90 DAPCSGALSAAGVVVTRSV 108 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 77 RPSQQLRSLNGEW 89 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 155 DAPCSGALSAAGVVVTRSV 173 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 142 RPSQQLRSLNGEW 154 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 97 DAPCSGALSAAGVVVTRSV 115 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 84 RPSQQLRSLNGEW 96 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 392 DAPCSGALSAAGVVVTRSV 410 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 379 RPSQQLRSLNGEW 391 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 132 DAPCSGALSAAGVVVTRSV 150 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 119 RPSQQLRSLNGEW 131 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 102 DAPCSGALSAAGVVVTRSV 120 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 89 RPSQQLRSLNGEW 101 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_56899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 111 DAPCSGALSAAGVVVTRSV 129 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 98 RPSQQLRSLNGEW 110 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 95 DAPCSGALSAAGVVVTRSV 113 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 82 RPSQQLRSLNGEW 94 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 186 DAPCSGALSAAGVVVTRSV 204 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 173 RPSQQLRSLNGEW 185 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 115 DAPCSGALSAAGVVVTRSV 133 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 102 RPSQQLRSLNGEW 114 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 91 DAPCSGALSAAGVVVTRSV 109 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 78 RPSQQLRSLNGEW 90 >SB_56712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 195 DAPCSGALSAAGVVVTRSV 213 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 182 RPSQQLRSLNGEW 194 >SB_56631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 112 DAPCSGALSAAGVVVTRSV 130 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 99 RPSQQLRSLNGEW 111 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 86 DAPCSGALSAAGVVVTRSV 104 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 73 RPSQQLRSLNGEW 85 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 125 DAPCSGALSAAGVVVTRSV 143 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 112 RPSQQLRSLNGEW 124 >SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 87 DAPCSGALSAAGVVVTRSV 105 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 74 RPSQQLRSLNGEW 86 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 119 DAPCSGALSAAGVVVTRSV 137 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 106 RPSQQLRSLNGEW 118 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 108 DAPCSGALSAAGVVVTRSV 126 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 95 RPSQQLRSLNGEW 107 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 121 DAPCSGALSAAGVVVTRSV 139 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 108 RPSQQLRSLNGEW 120 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 117 DAPCSGALSAAGVVVTRSV 135 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 104 RPSQQLRSLNGEW 116 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 308 DAPCSGALSAAGVVVTRSV 326 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 295 RPSQQLRSLNGEW 307 >SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 102 DAPCSGALSAAGVVVTRSV 120 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 89 RPSQQLRSLNGEW 101 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 88 DAPCSGALSAAGVVVTRSV 106 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 75 RPSQQLRSLNGEW 87 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 89 DAPCSGALSAAGVVVTRSV 107 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 76 RPSQQLRSLNGEW 88 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 153 DAPCSGALSAAGVVVTRSV 171 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 140 RPSQQLRSLNGEW 152 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 166 DAPCSGALSAAGVVVTRSV 184 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 153 RPSQQLRSLNGEW 165 >SB_55775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 110 DAPCSGALSAAGVVVTRSV 128 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 97 RPSQQLRSLNGEW 109 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 89 DAPCSGALSAAGVVVTRSV 107 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 76 RPSQQLRSLNGEW 88 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 86 DAPCSGALSAAGVVVTRSV 104 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 73 RPSQQLRSLNGEW 85 >SB_55207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 448 DAPCSGALSAAGVVVTRSV 466 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 435 RPSQQLRSLNGEW 447 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 97 DAPCSGALSAAGVVVTRSV 115 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 84 RPSQQLRSLNGEW 96 >SB_55081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 106 DAPCSGALSAAGVVVTRSV 124 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 93 RPSQQLRSLNGEW 105 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 88 DAPCSGALSAAGVVVTRSV 106 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 75 RPSQQLRSLNGEW 87 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 171 DAPCSGALSAAGVVVTRSV 189 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 158 RPSQQLRSLNGEW 170 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 107 DAPCSGALSAAGVVVTRSV 125 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 94 RPSQQLRSLNGEW 106 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 117 DAPCSGALSAAGVVVTRSV 135 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 104 RPSQQLRSLNGEW 116 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 120 DAPCSGALSAAGVVVTRSV 138 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 107 RPSQQLRSLNGEW 119 >SB_54479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 466 DAPCSGALSAAGVVVTRSV 484 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 453 RPSQQLRSLNGEW 465 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 119 DAPCSGALSAAGVVVTRSV 137 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 106 RPSQQLRSLNGEW 118 >SB_54117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_54116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 89 DAPCSGALSAAGVVVTRSV 107 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 76 RPSQQLRSLNGEW 88 >SB_54092| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 108 DAPCSGALSAAGVVVTRSV 126 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 95 RPSQQLRSLNGEW 107 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 98 DAPCSGALSAAGVVVTRSV 116 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 85 RPSQQLRSLNGEW 97 >SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 101 DAPCSGALSAAGVVVTRSV 119 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 88 RPSQQLRSLNGEW 100 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 213 DAPCSGALSAAGVVVTRSV 231 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 200 RPSQQLRSLNGEW 212 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_53629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 117 DAPCSGALSAAGVVVTRSV 135 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 104 RPSQQLRSLNGEW 116 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 104 DAPCSGALSAAGVVVTRSV 122 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 91 RPSQQLRSLNGEW 103 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 106 DAPCSGALSAAGVVVTRSV 124 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 93 RPSQQLRSLNGEW 105 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 115 DAPCSGALSAAGVVVTRSV 133 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 102 RPSQQLRSLNGEW 114 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_53123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_52872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_52828| Best HMM Match : Apidaecin (HMM E-Value=4.5) Length = 129 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 90 DAPCSGALSAAGVVVTRSV 108 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 77 RPSQQLRSLNGEW 89 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 237 DAPCSGALSAAGVVVTRSV 255 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 224 RPSQQLRSLNGEW 236 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 86 DAPCSGALSAAGVVVTRSV 104 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 73 RPSQQLRSLNGEW 85 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 92 DAPCSGALSAAGVVVTRSV 110 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 79 RPSQQLRSLNGEW 91 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 106 DAPCSGALSAAGVVVTRSV 124 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 93 RPSQQLRSLNGEW 105 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 103 DAPCSGALSAAGVVVTRSV 121 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 90 RPSQQLRSLNGEW 102 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_52419| Best HMM Match : Drf_DAD (HMM E-Value=2.5) Length = 146 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 108 DAPCSGALSAAGVVVTRSV 126 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 95 RPSQQLRSLNGEW 107 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 86 DAPCSGALSAAGVVVTRSV 104 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 73 RPSQQLRSLNGEW 85 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 87 DAPCSGALSAAGVVVTRSV 105 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 74 RPSQQLRSLNGEW 86 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 101 DAPCSGALSAAGVVVTRSV 119 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 88 RPSQQLRSLNGEW 100 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 91 DAPCSGALSAAGVVVTRSV 109 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 78 RPSQQLRSLNGEW 90 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 93 DAPCSGALSAAGVVVTRSV 111 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 80 RPSQQLRSLNGEW 92 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 136 DAPCSGALSAAGVVVTRSV 154 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 123 RPSQQLRSLNGEW 135 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 392 DAPCSGALSAAGVVVTRSV 410 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 379 RPSQQLRSLNGEW 391 >SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_51754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) Length = 181 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 142 DAPCSGALSAAGVVVTRSV 160 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 129 RPSQQLRSLNGEW 141 >SB_51567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 161 DAPCSGALSAAGVVVTRSV 179 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 148 RPSQQLRSLNGEW 160 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_51356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_51272| Best HMM Match : SMC_hinge (HMM E-Value=6.3) Length = 93 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 55 DAPCSGALSAAGVVVTRSV 73 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 42 RPSQQLRSLNGEW 54 >SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 92 DAPCSGALSAAGVVVTRSV 110 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 79 RPSQQLRSLNGEW 91 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 138 DAPCSGALSAAGVVVTRSV 156 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 125 RPSQQLRSLNGEW 137 >SB_51070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 88 DAPCSGALSAAGVVVTRSV 106 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 75 RPSQQLRSLNGEW 87 >SB_50749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 346 DAPCSGALSAAGVVVTRSV 364 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 333 RPSQQLRSLNGEW 345 >SB_50634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 109 DAPCSGALSAAGVVVTRSV 127 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 96 RPSQQLRSLNGEW 108 >SB_50512| Best HMM Match : Kelch_1 (HMM E-Value=0.17) Length = 119 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 80 DAPCSGALSAAGVVVTRSV 98 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 67 RPSQQLRSLNGEW 79 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 110 DAPCSGALSAAGVVVTRSV 128 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 97 RPSQQLRSLNGEW 109 >SB_50488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_50482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 88 DAPCSGALSAAGVVVTRSV 106 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 75 RPSQQLRSLNGEW 87 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 463 DAPCSGALSAAGVVVTRSV 481 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 450 RPSQQLRSLNGEW 462 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 147 DAPCSGALSAAGVVVTRSV 165 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 134 RPSQQLRSLNGEW 146 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 103 DAPCSGALSAAGVVVTRSV 121 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 90 RPSQQLRSLNGEW 102 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 95 DAPCSGALSAAGVVVTRSV 113 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 82 RPSQQLRSLNGEW 94 >SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_50012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_49975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 94 DAPCSGALSAAGVVVTRSV 112 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 81 RPSQQLRSLNGEW 93 >SB_49917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 49 DAPCSGALSAAGVVVTRSV 67 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 36 RPSQQLRSLNGEW 48 >SB_49901| Best HMM Match : DoxX (HMM E-Value=6.2) Length = 143 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 104 DAPCSGALSAAGVVVTRSV 122 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 91 RPSQQLRSLNGEW 103 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 145 DAPCSGALSAAGVVVTRSV 163 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 132 RPSQQLRSLNGEW 144 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 95 DAPCSGALSAAGVVVTRSV 113 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 82 RPSQQLRSLNGEW 94 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 263 DAPCSGALSAAGVVVTRSV 281 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 250 RPSQQLRSLNGEW 262 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 95 DAPCSGALSAAGVVVTRSV 113 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 82 RPSQQLRSLNGEW 94 >SB_49761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_49678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 43 DAPCSGALSAAGVVVTRSV 61 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 30 RPSQQLRSLNGEW 42 >SB_49547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_49509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 90 DAPCSGALSAAGVVVTRSV 108 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 77 RPSQQLRSLNGEW 89 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 95 DAPCSGALSAAGVVVTRSV 113 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 82 RPSQQLRSLNGEW 94 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 199 DAPCSGALSAAGVVVTRSV 217 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 186 RPSQQLRSLNGEW 198 >SB_49332| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 50 DAPCSGALSAAGVVVTRSV 68 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 37 RPSQQLRSLNGEW 49 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 103 DAPCSGALSAAGVVVTRSV 121 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 90 RPSQQLRSLNGEW 102 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 97 DAPCSGALSAAGVVVTRSV 115 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 84 RPSQQLRSLNGEW 96 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 87 DAPCSGALSAAGVVVTRSV 105 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 74 RPSQQLRSLNGEW 86 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 107 DAPCSGALSAAGVVVTRSV 125 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 94 RPSQQLRSLNGEW 106 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 247 DAPCSGALSAAGVVVTRSV 265 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 234 RPSQQLRSLNGEW 246 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 104 DAPCSGALSAAGVVVTRSV 122 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 91 RPSQQLRSLNGEW 103 >SB_48922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_48921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_48874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_48840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 105 DAPCSGALSAAGVVVTRSV 123 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 92 RPSQQLRSLNGEW 104 >SB_48531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 31 DAPCSGALSAAGVVVTRSV 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 18 RPSQQLRSLNGEW 30 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 84 DAPCSGALSAAGVVVTRSV 102 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 71 RPSQQLRSLNGEW 83 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 138 DAPCSGALSAAGVVVTRSV 156 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 125 RPSQQLRSLNGEW 137 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSV 441 DAPCSGALSAAGVVVTRSV Sbjct: 101 DAPCSGALSAAGVVVTRSV 119 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 2 RPSQQLRTSNGEW 40 RPSQQLR+ NGEW Sbjct: 88 RPSQQLRSLNGEW 100 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,243,985 Number of Sequences: 59808 Number of extensions: 371114 Number of successful extensions: 8028 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4699 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8028 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -