BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0042.Seq (626 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z46267-2|CAC42301.1| 600|Caenorhabditis elegans Hypothetical pr... 29 3.6 AF228712-1|AAF34798.1| 91|Caenorhabditis elegans molybdenum co... 29 3.6 U34661-1|AAA92006.1| 962|Caenorhabditis elegans ionotropic glut... 27 8.3 L16559-2|AAA27933.3| 962|Caenorhabditis elegans Glutamate recep... 27 8.3 >Z46267-2|CAC42301.1| 600|Caenorhabditis elegans Hypothetical protein F49E2.1b protein. Length = 600 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +1 Query: 157 RDRVECCSSLEQESTIKERGLQRQRAKNRLSGRGPLREPS 276 RDR+ C S EQ S + ++ + ++A++ + G EP+ Sbjct: 343 RDRIRCGDSDEQLSEVIQKAVNNKKARHAVFRNGRSEEPA 382 >AF228712-1|AAF34798.1| 91|Caenorhabditis elegans molybdenum cofactor synthesis-step1 protein MOCS1A-B protein. Length = 91 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +1 Query: 157 RDRVECCSSLEQESTIKERGLQRQRAKNRLSGRGPLREPS 276 RDR+ C S EQ S + ++ + ++A++ + G EP+ Sbjct: 21 RDRIRCGDSDEQLSEVIQKAVNNKKARHAVFRNGRSEEPA 60 >U34661-1|AAA92006.1| 962|Caenorhabditis elegans ionotropic glutamate receptor subunitprotein. Length = 962 Score = 27.5 bits (58), Expect = 8.3 Identities = 18/62 (29%), Positives = 26/62 (41%) Frame = -3 Query: 210 FFNSGLLFQTGTTLNPISVYSFDL*GILPISAYWLKNELI*QKFNANFNKILTLTICHSP 31 +F Q GT + P S+ G + SA+W +I + AN LTL +P Sbjct: 643 WFTLAAFMQQGTDILPRSIS-----GRIASSAWWFFTMIIVSSYTANLAAFLTLEKMQAP 697 Query: 30 FE 25 E Sbjct: 698 IE 699 >L16559-2|AAA27933.3| 962|Caenorhabditis elegans Glutamate receptor family (ampa)protein 1 protein. Length = 962 Score = 27.5 bits (58), Expect = 8.3 Identities = 18/62 (29%), Positives = 26/62 (41%) Frame = -3 Query: 210 FFNSGLLFQTGTTLNPISVYSFDL*GILPISAYWLKNELI*QKFNANFNKILTLTICHSP 31 +F Q GT + P S+ G + SA+W +I + AN LTL +P Sbjct: 643 WFTLAAFMQQGTDILPRSIS-----GRIASSAWWFFTMIIVSSYTANLAAFLTLEKMQAP 697 Query: 30 FE 25 E Sbjct: 698 IE 699 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,542,786 Number of Sequences: 27780 Number of extensions: 274727 Number of successful extensions: 548 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 522 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 548 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1374536540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -