BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0035.Seq (729 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0133 - 14057469-14057497,14057516-14057581,14057770-140583... 29 3.8 07_03_1101 + 23967298-23967366,23968918-23969021,23969616-239697... 29 5.0 >12_02_0133 - 14057469-14057497,14057516-14057581,14057770-14058363, 14058450-14058570,14058926-14059320,14059410-14059534, 14059646-14059876,14060012-14060484,14060587-14060693, 14060842-14061172,14061222-14061250,14061345-14061901, 14062170-14062255,14062344-14062406,14062646-14063001, 14063101-14063356 Length = 1272 Score = 29.1 bits (62), Expect = 3.8 Identities = 20/72 (27%), Positives = 32/72 (44%) Frame = -2 Query: 530 PTRPAVNG*SRYQIRILNFFAIAIDKYISY*VNICHRRLESTIIKAGNVTFGQLLVNQKN 351 PT+ NG S I + FFA D Y +Y + L++ + GN+ +LL+ N Sbjct: 806 PTQFQENGPSYENIGLF-FFARDTDSYENYYSKLVENMLKNDLALRGNIETAELLIFPSN 864 Query: 350 ELLTLYSMTKLF 315 L + +F Sbjct: 865 ILSKNFQRWNMF 876 >07_03_1101 + 23967298-23967366,23968918-23969021,23969616-23969716, 23969792-23969858,23969910-23970045,23970470-23970583, 23970649-23970786,23970865-23970949,23971029-23971075, 23971216-23971351,23971396-23971436 Length = 345 Score = 28.7 bits (61), Expect = 5.0 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 725 DLHAKATEYLVAATKDES 672 D H+KAT YLV A DES Sbjct: 31 DFHSKATNYLVTACDDES 48 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,305,945 Number of Sequences: 37544 Number of extensions: 314427 Number of successful extensions: 583 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 567 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 583 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1909952136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -