BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0035.Seq (729 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylch... 23 7.3 AY187043-1|AAO39757.1| 171|Anopheles gambiae putative antennal ... 23 7.3 DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domai... 23 9.7 >AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 5 protein. Length = 533 Score = 23.4 bits (48), Expect = 7.3 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -1 Query: 333 FNDKTLLNDILDK*QVKYLPLYN 265 +N+K LL+D+LD + P+ N Sbjct: 37 YNEKRLLHDLLDSYNILERPVVN 59 >AY187043-1|AAO39757.1| 171|Anopheles gambiae putative antennal carrier protein AP-1 protein. Length = 171 Score = 23.4 bits (48), Expect = 7.3 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -3 Query: 181 NAQIATFDNRRLTYDIHNAVQIIQKCFVVLINVKHHSLICPLT 53 N IA+FDNR TY+ H+ I I H +++ L+ Sbjct: 122 NGNIASFDNRGNTYN-HSGTGDIHSYLYEQIEDLHKAILDQLS 163 >DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domain protein protein. Length = 103 Score = 23.0 bits (47), Expect = 9.7 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 167 GNLCIWTKKC 196 G CIW KKC Sbjct: 84 GGSCIWAKKC 93 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 708,583 Number of Sequences: 2352 Number of extensions: 13897 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -