BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0033.Seq (615 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC25G10.03 |zip1||transcription factor Zip1|Schizosaccharomyce... 29 0.71 SPBC530.06c |||translation initiation factor eIF3 alpha subunit ... 28 1.2 SPAPB1E7.09 |ogm2|oma2|protein O-mannosyltransferase Ogm2|Schizo... 27 2.8 SPBP35G2.07 |ilv1||acetolactate synthase catalytic subunit|Schiz... 25 6.6 SPBC800.14c |||DUF1772 family protein|Schizosaccharomyces pombe|... 25 8.7 SPCC1223.12c |meu10||GPI anchored cell surface protein |Schizosa... 25 8.7 SPCC1442.05c |||conserved fungal protein|Schizosaccharomyces pom... 25 8.7 >SPAC25G10.03 |zip1||transcription factor Zip1|Schizosaccharomyces pombe|chr 1|||Manual Length = 330 Score = 28.7 bits (61), Expect = 0.71 Identities = 18/58 (31%), Positives = 34/58 (58%) Frame = +3 Query: 276 TYSSKALMSGNVKNAQIASVKVQYLDKQKKLAVMNIEYN*VSEQLTLLSRKMRFNQKA 449 T+S+ +GN +A AS+ + YLD QK L + +++ +++ T R++ F QK+ Sbjct: 97 TFSAPLNATGNFSSANPASIDLAYLDLQKLLTLP--DHSKETQEKTSSQREL-FEQKS 151 >SPBC530.06c |||translation initiation factor eIF3 alpha subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 1173 Score = 27.9 bits (59), Expect = 1.2 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +3 Query: 498 AYSCVQGDITKLAVDVIVNAANPSLMGSGGVDGAIHR 608 AYS V DI + + + +NPSL+G+ VD A HR Sbjct: 431 AYSAVGKDILAIRLLNQFDLSNPSLLGTCVVDYAGHR 467 >SPAPB1E7.09 |ogm2|oma2|protein O-mannosyltransferase Ogm2|Schizosaccharomyces pombe|chr 1|||Manual Length = 739 Score = 26.6 bits (56), Expect = 2.8 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 379 FITASFFCLSRYCTFTEAICAF 314 FI ++FFCLSRY + +A F Sbjct: 202 FIISTFFCLSRYHVYHKAPFTF 223 >SPBP35G2.07 |ilv1||acetolactate synthase catalytic subunit|Schizosaccharomyces pombe|chr 2|||Manual Length = 669 Score = 25.4 bits (53), Expect = 6.6 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 6/34 (17%) Frame = +1 Query: 121 SLFFPFIAIAGSTVQGGVIHF------YGQIVEP 204 SLF P +A + +GG+IHF G++V+P Sbjct: 382 SLFAPQARLAAAEERGGIIHFDISPKNIGKVVQP 415 >SPBC800.14c |||DUF1772 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 160 Score = 25.0 bits (52), Expect = 8.7 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +1 Query: 115 LGSLFFPFIAIAGSTVQG 168 +G FPF+AIA + VQG Sbjct: 51 MGKKSFPFLAIANALVQG 68 >SPCC1223.12c |meu10||GPI anchored cell surface protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 416 Score = 25.0 bits (52), Expect = 8.7 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -2 Query: 125 KLPSIREFKKGLNIYSISSMISHP 54 +LP +R+ K GLNI + SS + P Sbjct: 309 ELPKLRDVKGGLNIQTTSSDFTCP 332 >SPCC1442.05c |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 177 Score = 25.0 bits (52), Expect = 8.7 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 471 EGVRRRYENAYSCVQGD 521 EGV++ YENA ++GD Sbjct: 161 EGVQKHYENAVKKIKGD 177 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,559,427 Number of Sequences: 5004 Number of extensions: 53241 Number of successful extensions: 101 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 101 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 269634532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -