BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0023X.Seq (452 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK055141-1|BAB70862.1| 260|Homo sapiens protein ( Homo sapiens ... 29 9.8 >AK055141-1|BAB70862.1| 260|Homo sapiens protein ( Homo sapiens cDNA FLJ30579 fis, clone BRAWH2006989, weakly similar to DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT (EC 2.7.7.6). ). Length = 260 Score = 28.7 bits (61), Expect = 9.8 Identities = 20/52 (38%), Positives = 24/52 (46%) Frame = -3 Query: 408 NGRYWMWTRSLRSRWKSSPWMTASAHRATSETTWASTHRRPAPRWSTATSHA 253 N Y WT S S PW + HR+ S W S HR +P WS SH+ Sbjct: 72 NRAYNSWTGSSHKN-HSPPW---NPHRSHSPP-W-SPHRSHSPPWSPHRSHS 117 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 58,124,666 Number of Sequences: 237096 Number of extensions: 974730 Number of successful extensions: 2025 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1966 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2023 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 3758237868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -