BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0021.Seq (783 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1002.15c |pmc5|med6|mediator complex subunit Pmc5 |Schizosac... 27 4.0 SPAC14C4.11 |||polyphosphate synthetase |Schizosaccharomyces pom... 26 7.0 >SPAC1002.15c |pmc5|med6|mediator complex subunit Pmc5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 216 Score = 26.6 bits (56), Expect = 4.0 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = -1 Query: 177 IITYFNDFPFHKQKSSNNVLILEC*WTAIPTFD 79 ++ YF+ PF+ KS+N +L ++ + A+ D Sbjct: 33 VLEYFSQSPFYSHKSNNEMLKMQSQFNALDLGD 65 >SPAC14C4.11 |||polyphosphate synthetase |Schizosaccharomyces pombe|chr 1|||Manual Length = 734 Score = 25.8 bits (54), Expect = 7.0 Identities = 18/62 (29%), Positives = 35/62 (56%), Gaps = 4/62 (6%) Frame = +1 Query: 19 IYTLIIFQL---SWKVESVRNNLIKSWYCCPLT-F*NQNIIRTFLFMKGKIIKVSYNLRN 186 +YTL+ + +WK+ + R+ +IKS P+T + I+ T L + I+ +S+ L++ Sbjct: 658 VYTLLAIFIGFYAWKLHAKRSQMIKSRSPAPMTDYWGPLIVGTALAI-SLIVNMSFALKD 716 Query: 187 TV 192 V Sbjct: 717 AV 718 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,923,055 Number of Sequences: 5004 Number of extensions: 56398 Number of successful extensions: 85 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 379359666 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -