BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0021.Seq (783 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0724 - 26696401-26696703,26696875-26697025,26697115-266971... 31 1.4 12_01_0054 + 463743-464414,464896-465024,465336-465440,465524-46... 29 3.2 11_01_0054 + 416626-417297,417757-417885,418197-418301,418385-41... 29 4.2 >11_06_0724 - 26696401-26696703,26696875-26697025,26697115-26697184, 26697526-26697736,26697928-26698085,26698684-26699500 Length = 569 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/43 (27%), Positives = 25/43 (58%) Frame = -2 Query: 458 ILECSLSLILNVCFPCIENLNDQICM*Y*TREVD*I*TLKCNL 330 + +C+ L+ ++C+ C++N +D + R+ I L+CNL Sbjct: 221 LAQCAPDLVEDICYNCLQNFSDLATANFAGRQGGRILALRCNL 263 >12_01_0054 + 463743-464414,464896-465024,465336-465440,465524-465917, 466325-466422,466505-466753,466920-466979 Length = 568 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -2 Query: 485 LILS*NKIKILECSLSLILNVCFPCIENLND 393 L L NK+ IL+ S ++I+ CFP I L + Sbjct: 208 LALKCNKLNILDLSYTMIVKKCFPAIMKLQN 238 >11_01_0054 + 416626-417297,417757-417885,418197-418301,418385-418778, 419186-419283,419366-419614,419784-419843 Length = 568 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -2 Query: 485 LILS*NKIKILECSLSLILNVCFPCIENL 399 L L NK+ IL+ S ++I+ CFP I L Sbjct: 208 LALKCNKLNILDLSYTMIVKKCFPAIMKL 236 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,766,780 Number of Sequences: 37544 Number of extensions: 264990 Number of successful extensions: 327 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 323 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 327 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2103658836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -