BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0021.Seq (783 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g02500.1 68415.m00189 expressed protein contains Pfam profile... 33 0.21 >At2g02500.1 68415.m00189 expressed protein contains Pfam profile: PF01128 uncharacterized protein family UPF0007; identical to GP:12697583 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase {Arabidopsis thaliana}; identical to cDNA 4-Diphosphocytidyl-2C-methyl-D-erythritol synthase (ISPD) GI:7385140 Length = 302 Score = 33.1 bits (72), Expect = 0.21 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 5/53 (9%) Frame = +2 Query: 305 GIIFSKIFINYILKFKSNQLLWFSITCRFDRLDFQCKENKH-----LILMISC 448 G I S F+ LK K N LWFS + +LDF + N+ L+L I C Sbjct: 9 GFITSPTFLCPKLKVKLNSYLWFSYRSQVQKLDFSKRVNRSYKRDALLLSIKC 61 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,252,250 Number of Sequences: 28952 Number of extensions: 258024 Number of successful extensions: 360 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 354 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 360 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1755792000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -