BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0019.Seq (563 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L36067-1|AAA29362.1| 229|Anopheles gambiae polyubiquitin protein. 143 4e-36 AF510715-1|AAP47144.1| 470|Anopheles gambiae Rh-like glycoprote... 26 0.98 AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylch... 25 1.7 AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylch... 24 3.9 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 24 3.9 X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 23 9.1 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 9.1 AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 23 9.1 >L36067-1|AAA29362.1| 229|Anopheles gambiae polyubiquitin protein. Length = 229 Score = 143 bits (346), Expect = 4e-36 Identities = 69/70 (98%), Positives = 70/70 (100%) Frame = +3 Query: 12 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYN 191 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYN Sbjct: 1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60 Query: 192 IQKESTLHLV 221 IQKESTLHLV Sbjct: 61 IQKESTLHLV 70 Score = 143 bits (346), Expect = 4e-36 Identities = 69/70 (98%), Positives = 70/70 (100%) Frame = +3 Query: 12 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYN 191 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYN Sbjct: 77 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136 Query: 192 IQKESTLHLV 221 IQKESTLHLV Sbjct: 137 IQKESTLHLV 146 Score = 143 bits (346), Expect = 4e-36 Identities = 69/70 (98%), Positives = 70/70 (100%) Frame = +3 Query: 12 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYN 191 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYN Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212 Query: 192 IQKESTLHLV 221 IQKESTLHLV Sbjct: 213 IQKESTLHLV 222 >AF510715-1|AAP47144.1| 470|Anopheles gambiae Rh-like glycoprotein protein. Length = 470 Score = 25.8 bits (54), Expect = 0.98 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 2 ESEDANFRKDPHGQDHH 52 ESE N RK PH QD H Sbjct: 50 ESEGGNLRKYPHFQDIH 66 >AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 25.0 bits (52), Expect = 1.7 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = -2 Query: 559 SDTVSRFYLKSIIHSSRSVSYRLEGTYLFVVVFEDHRAVTLPAVVTVLHHR 407 S TV + +I + S + L GTY ++F +V L VV HHR Sbjct: 272 SQTVFSLLVGHVI-TKTSEAVPLLGTYFNCIMFMVASSVVLTVVVLNYHHR 321 >AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 23.8 bits (49), Expect = 3.9 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -2 Query: 493 LEGTYLFVVVFEDHRAVTLPAVVTVLHHR 407 L GTY ++F +V L VV HHR Sbjct: 293 LLGTYFNCIMFMVASSVVLTVVVLNYHHR 321 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 23.8 bits (49), Expect = 3.9 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = -2 Query: 514 SRSVSYRLEGTYLFVVVFEDHRAVTLPAVVTVLHHRHEHSG 392 S S+ +L T + V+ F DH+A+T+ + +R ++G Sbjct: 206 SSSLETQLRTTDMHVLSFSDHKALTVRLCLPTPPNRLTNNG 246 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 22.6 bits (46), Expect = 9.1 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +1 Query: 244 RNAREELLHTQEDQAQEEEGQTSRPQVLQGR 336 + A + LL TQ+ Q Q+++ Q + Q QG+ Sbjct: 640 QQAIKALLATQQLQQQQQQQQQQQQQQQQGQ 670 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 22.6 bits (46), Expect = 9.1 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -2 Query: 466 VFEDHRAVTLPAVVTVLHHRHE 401 +F DHR PA V L HE Sbjct: 903 IFIDHRGHKAPAAVVGLQFLHE 924 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 22.6 bits (46), Expect = 9.1 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 176 PLGLQYPEGIHPPPGV 223 P G+ P G H PPG+ Sbjct: 5 PPGVNRPPGSHRPPGL 20 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 566,630 Number of Sequences: 2352 Number of extensions: 12461 Number of successful extensions: 32 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52983882 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -