BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0014.Seq (636 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 25 1.5 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 24 4.6 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 25.4 bits (53), Expect = 1.5 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 492 RAAPDSPARVPGSPPGRSGEEKFH 563 R A SPA P SPP +GE + Sbjct: 294 RLAGSSPAAAPPSPPTSAGESNHY 317 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 23.8 bits (49), Expect = 4.6 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +2 Query: 329 RRRGSTWEAGCGKYRSHGPKARRCHHDRQAQSSPQR 436 RRR W + RSH +ARR +A+SS QR Sbjct: 268 RRRAYWWTTEIAQCRSHCIEARR--KMNRAKSSEQR 301 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 576,275 Number of Sequences: 2352 Number of extensions: 11576 Number of successful extensions: 30 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -