Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= pg--0007.Seq
         (757 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetyla...    23   3.5  
AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    22   4.6  

>EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetylase
           1 protein.
          Length = 534

 Score = 22.6 bits (46), Expect = 3.5
 Identities = 10/35 (28%), Positives = 17/35 (48%)
 Frame = +1

Query: 526 NCSSLKYLKCTHSDYEARKSPESLFFVTTSPCREW 630
           NC  +  ++CT S  +A + P  L+F       +W
Sbjct: 58  NCRDV--IQCTSSGLQAIRCPAGLYFDIDKQTCDW 90


>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like
           protein protein.
          Length = 1156

 Score = 22.2 bits (45), Expect = 4.6
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = +3

Query: 102 DDPRISPLTSP 134
           D P +SPLTSP
Sbjct: 909 DKPSVSPLTSP 919


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 168,609
Number of Sequences: 336
Number of extensions: 3621
Number of successful extensions: 7
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 20234955
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)