BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0006.Seq (765 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A3ERZ4 Cluster: Putative uncharacterized protein; n=1; ... 34 4.4 UniRef50_UPI0000499B66 Cluster: hypothetical protein 25.t00011; ... 33 5.9 >UniRef50_A3ERZ4 Cluster: Putative uncharacterized protein; n=1; Leptospirillum sp. Group II UBA|Rep: Putative uncharacterized protein - Leptospirillum sp. Group II UBA Length = 499 Score = 33.9 bits (74), Expect = 4.4 Identities = 23/69 (33%), Positives = 31/69 (44%), Gaps = 1/69 (1%) Frame = +1 Query: 277 PVTFFFPDLFLPGVRNTVSKPEPLASLIMHLTVHTDVFVASEVCFNFSISFF-PCFIMKQ 453 P T+ F +F PG R T S +A L + + VC +S PC + K Sbjct: 203 PCTYPFRVVFAPGARGTSSDVVYVACTSPELLGSSPPAASIFVCSIEELSSTTPCSVYKS 262 Query: 454 YTSYTNFLP 480 YTSY + LP Sbjct: 263 YTSYNSSLP 271 >UniRef50_UPI0000499B66 Cluster: hypothetical protein 25.t00011; n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical protein 25.t00011 - Entamoeba histolytica HM-1:IMSS Length = 207 Score = 33.5 bits (73), Expect = 5.9 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 358 IMHLTVHTDVFVASEVCFNFSISFFPCFIMKQYTSYTNFL 477 I+H + D+F S C F + P FI+ Y+SY + Sbjct: 96 ILHSVIINDIFALSMCCIGFGVYVAPLFIIGIYSSYNEMI 135 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 688,642,123 Number of Sequences: 1657284 Number of extensions: 13666005 Number of successful extensions: 35464 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 34074 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35452 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 63792713725 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -