BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0006.Seq (765 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78198-9|CAE17828.1| 164|Caenorhabditis elegans Hypothetical pr... 31 1.2 AC025715-2|AAK68447.2| 439|Caenorhabditis elegans Hypothetical ... 28 6.3 >Z78198-9|CAE17828.1| 164|Caenorhabditis elegans Hypothetical protein F55C5.10 protein. Length = 164 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/54 (29%), Positives = 29/54 (53%) Frame = -3 Query: 187 EKFKEDINFNGSE*SLRRIMKELGFRWKKRTENNRKLVNEKSNIRLLRIEYLQK 26 +K +E+ +LRR + LGF+ N+KL +EK +++ R E+ +K Sbjct: 74 KKIEEEKEIRKERRTLRRQNRFLGFQNDLLVHQNQKLASEKHELKVERQEFAEK 127 >AC025715-2|AAK68447.2| 439|Caenorhabditis elegans Hypothetical protein Y38F2AR.6 protein. Length = 439 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/24 (58%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = -3 Query: 145 SLRRIMKELG-FRWKKRTENNRKL 77 +LR KE+G FRWKK TEN K+ Sbjct: 416 TLRNSHKEVGVFRWKKLTENLGKI 439 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,198,902 Number of Sequences: 27780 Number of extensions: 340500 Number of successful extensions: 872 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 859 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 872 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1830096852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -