BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0003X.Seq (548 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0038 - 282431-283954 28 4.3 12_02_1090 - 25994366-25995410,25995632-25995971,25997266-25997686 27 7.5 >08_01_0038 - 282431-283954 Length = 507 Score = 28.3 bits (60), Expect = 4.3 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 1/73 (1%) Frame = +1 Query: 7 FPTVAQL*W-RMANCKR*YFVKIRVKFLLNQLIF*PIGRNRQNPL*ITRIDRDRVECCSS 183 FP++A+L R C + Y VK R LL+QLI + R + L + D ++ S Sbjct: 227 FPSLARLPVVRRLLCAKAYHVKRRWDQLLDQLIDDHASKRRSSMLDNNDEESDFIDVLLS 286 Query: 184 LEQESTITERGLQ 222 ++QE +T+ ++ Sbjct: 287 IQQEYGLTKDNIK 299 >12_02_1090 - 25994366-25995410,25995632-25995971,25997266-25997686 Length = 601 Score = 27.5 bits (58), Expect = 7.5 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -2 Query: 508 KVQPDAPFTAALSAAGV 458 ++ PDAPF+ A SAAG+ Sbjct: 333 EIDPDAPFSVAFSAAGM 349 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,721,093 Number of Sequences: 37544 Number of extensions: 292800 Number of successful extensions: 652 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 646 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 652 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1233951264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -