Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS335E02f
         (521 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

11_01_0780 - 6531579-6531608,6531732-6532064,6533219-6533325,653...    29   2.3  

>11_01_0780 -
           6531579-6531608,6531732-6532064,6533219-6533325,
           6534267-6534316,6535110-6537065,6537458-6538209
          Length = 1075

 Score = 29.1 bits (62), Expect = 2.3
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 1/70 (1%)
 Frame = +1

Query: 58  DDITILKPLFSM*IVIEKYSFTLYSSSQNY-ERLVIGTYDVVRNCGPRKYNILAVPVRYA 234
           DDI  +KPL S    +  +  + + S QN  ERL   + ++VRNCG     I+ +    A
Sbjct: 300 DDICKMKPL-SRDDSLNLFLNSAFGSEQNCSERLREVSTEIVRNCGGLPLGIINIARLLA 358

Query: 235 GHLELTLLFH 264
             ++   L+H
Sbjct: 359 SEVDNLELWH 368


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,075,508
Number of Sequences: 37544
Number of extensions: 226297
Number of successful extensions: 309
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 308
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 309
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1142636160
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)