BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ovS335A02f
(521 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
12_01_0496 + 3939731-3939758,3940459-3942773 27 9.1
>12_01_0496 + 3939731-3939758,3940459-3942773
Length = 780
Score = 27.1 bits (57), Expect = 9.1
Identities = 19/57 (33%), Positives = 26/57 (45%)
Frame = -3
Query: 339 Y*LISFIYRPFIKFLYTKNSIFYNIYWSKYNIFSTTFFRFSWNTSTIFRLSRLIYFM 169
Y + F R + Y IF N+YW + S T +R S+N S L +L FM
Sbjct: 164 YYTLRFDDRYVLSLAYDGPDIF-NLYWPNPDQSSWTNYRISYNRSRSGVLDKLGKFM 219
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,601,083
Number of Sequences: 37544
Number of extensions: 120536
Number of successful extensions: 223
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 217
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 223
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1142636160
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -