Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS333A10f
         (521 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC11E3.09 |pyp3||protein-tyrosine phosphatase Pyp3|Schizosacch...    25   9.0  

>SPAC11E3.09 |pyp3||protein-tyrosine phosphatase
           Pyp3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 303

 Score = 24.6 bits (51), Expect = 9.0
 Identities = 18/69 (26%), Positives = 35/69 (50%), Gaps = 1/69 (1%)
 Frame = +3

Query: 27  SSF*IFWKMMYVIV*MTNLIYLTVVNTYRHTNKLRLPVSYPA-AFIYLNRGNTVLIFLLF 203
           +S  +FWKM++  V  + +I   ++   R  ++L+  + +P   F  LN G+  L  +L 
Sbjct: 101 NSIDVFWKMVWQSVPKSGII--VMLTKLRERHRLKCDIYWPVELFETLNIGD--LSVILV 156

Query: 204 LKFQMTKFN 230
             + +T  N
Sbjct: 157 KVYTLTSLN 165


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,677,417
Number of Sequences: 5004
Number of extensions: 30590
Number of successful extensions: 43
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 42
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 43
length of database: 2,362,478
effective HSP length: 68
effective length of database: 2,022,206
effective search space used: 212331630
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)