Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS328C04f
         (521 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_01_1006 - 10191817-10191822,10192449-10192745,10192826-101929...    29   2.3  

>08_01_1006 -
           10191817-10191822,10192449-10192745,10192826-10192975,
           10194558-10195370
          Length = 421

 Score = 29.1 bits (62), Expect = 2.3
 Identities = 18/66 (27%), Positives = 33/66 (50%)
 Frame = -2

Query: 436 LRESEYSGIKYNIIYSLQTSCLVMRFYNMTLLQTEFSLKSY*TLSFTNGVYFNYSQSIEI 257
           + E+ +S +KY  +  +  S   +RF    L +TE SL+S+      +     Y ++  +
Sbjct: 346 INENSFSSLKYVSLSGITYSSNQLRFMKFLLSKTE-SLQSFAVTFLYSKSNKEYVKACRV 404

Query: 256 LKALRR 239
           L+A RR
Sbjct: 405 LRAFRR 410


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,700,110
Number of Sequences: 37544
Number of extensions: 164471
Number of successful extensions: 261
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 253
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 261
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1142636160
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)