Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS327H10f
         (521 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_01_0050 - 402808-402819,402920-402922,402999-403010,403832-40...    29   3.0  

>07_01_0050 -
           402808-402819,402920-402922,402999-403010,403832-404467
          Length = 220

 Score = 28.7 bits (61), Expect = 3.0
 Identities = 18/69 (26%), Positives = 32/69 (46%), Gaps = 1/69 (1%)
 Frame = +1

Query: 316 YDGSCVEAQRTSILGGSSFFRLCFWYSVFGLMGHDSPTGIF-LYYHKSTTNFLPLTHHYP 492
           +D +    +  S++GG+  FR+   Y V+      + TG+F L  + +T N   +    P
Sbjct: 126 HDDTTATVRELSVVGGTGKFRMATGYVVWKTASMSASTGVFELDVYVTTPNATTIDASAP 185

Query: 493 AIXQLPGAG 519
            +  L G G
Sbjct: 186 -VSPLDGGG 193


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,111,007
Number of Sequences: 37544
Number of extensions: 200555
Number of successful extensions: 545
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 525
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 545
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1142636160
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)