BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ovS325G06f
(521 letters)
Database: spombe
5004 sequences; 2,362,478 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SPAC57A7.10c |sec21||coatomer gamma subunit Sec21 |Schizosacchar... 27 2.2
>SPAC57A7.10c |sec21||coatomer gamma subunit Sec21
|Schizosaccharomyces pombe|chr 1|||Manual
Length = 905
Score = 26.6 bits (56), Expect = 2.2
Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 1/73 (1%)
Frame = +1
Query: 106 ANELKALASLYLKRSY-HYLLSASYFNNYQTNREGFAKLFRKLSDDSWEKTIGLIKHVTK 282
A + ALAS ++ + + L S S FN Y + +L++ E + ++KHV K
Sbjct: 630 AEDQNALASSNIETEFLNALESVSEFNEYGPVLKSSPSPI-ELTEQETEFVVKVVKHVFK 688
Query: 283 RGGKMDFSSHTTL 321
+ F H TL
Sbjct: 689 DHLVVQFQLHNTL 701
Database: spombe
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 2,362,478
Number of sequences in database: 5004
Lambda K H
0.317 0.132 0.382
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,955,582
Number of Sequences: 5004
Number of extensions: 36459
Number of successful extensions: 119
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 111
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 119
length of database: 2,362,478
effective HSP length: 68
effective length of database: 2,022,206
effective search space used: 212331630
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -