Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS325E06f
         (357 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M29494-1|AAA27729.1|   74|Apis mellifera protein ( Bee homeobox-...    21   3.3  
DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related pro...    21   4.4  
AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellif...    21   5.8  
DQ667194-1|ABG75746.1|  391|Apis mellifera cys-loop ligand-gated...    20   7.6  
AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein ...    20   7.6  

>M29494-1|AAA27729.1|   74|Apis mellifera protein ( Bee
           homeobox-containing gene,partial cds, clone H15. ).
          Length = 74

 Score = 21.4 bits (43), Expect = 3.3
 Identities = 10/18 (55%), Positives = 12/18 (66%)
 Frame = +2

Query: 131 FDNRRLKCVK*LGAVRNI 184
           F NRR+K  K L AV+ I
Sbjct: 56  FQNRRMKLKKELRAVKEI 73


>DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related
           protein STG-1 protein.
          Length = 397

 Score = 21.0 bits (42), Expect = 4.4
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -3

Query: 205 QHSFITFDIPD 173
           QH F+TFD+ +
Sbjct: 363 QHEFVTFDLDE 373


>AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellifera
           ORF for hypotheticalprotein. ).
          Length = 998

 Score = 20.6 bits (41), Expect = 5.8
 Identities = 12/43 (27%), Positives = 21/43 (48%)
 Frame = -2

Query: 338 DHSSVKISTGAVSSKFDVVRAVXSXIGKGFLDSERSQPXRRIL 210
           DH+S  +   AV SKF +   + +      + S  ++  RR+L
Sbjct: 690 DHASSPLEPSAVPSKFCLSVTLLTVATSLVIVSRYAEKSRRML 732


>DQ667194-1|ABG75746.1|  391|Apis mellifera cys-loop ligand-gated
          ion channel subunit protein.
          Length = 391

 Score = 20.2 bits (40), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +1

Query: 43 VFFEGDDYIQI 75
          +F EGDDY+ +
Sbjct: 53 IFEEGDDYVTL 63


>AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein 1
           protein.
          Length = 500

 Score = 20.2 bits (40), Expect = 7.6
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = +2

Query: 110 PNAQIATFDN 139
           PN ++AT+DN
Sbjct: 321 PNDEVATYDN 330


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 88,488
Number of Sequences: 438
Number of extensions: 1624
Number of successful extensions: 9
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 51
effective length of database: 124,005
effective search space used:  8308335
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)