SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS324C11f
         (521 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor p...    22   3.3  
DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.               21   5.8  
DQ667195-1|ABG75747.1|  469|Apis mellifera cys-loop ligand-gated...    21   7.7  
AB244761-1|BAE66603.1|  504|Apis mellifera cystathionine beta-sy...    21   7.7  

>AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor
           protein.
          Length = 587

 Score = 22.2 bits (45), Expect = 3.3
 Identities = 10/39 (25%), Positives = 15/39 (38%)
 Frame = +1

Query: 52  ISKPSTSASKESCSPAK*CTSSCGSIDPGYDSSSTSAAL 168
           +S PST      C+  +   S C      Y +  T + L
Sbjct: 343 VSYPSTETLNTKCNTLERTPSKCSQTSVHYSNGQTHSQL 381


>DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.
          Length = 828

 Score = 21.4 bits (43), Expect = 5.8
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = -2

Query: 118 TSWYITWRGSSS 83
           T+WY+ W+G  S
Sbjct: 672 TNWYMGWKGMLS 683


>DQ667195-1|ABG75747.1|  469|Apis mellifera cys-loop ligand-gated
           ion channel subunit protein.
          Length = 469

 Score = 21.0 bits (42), Expect = 7.7
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = +2

Query: 464 HLNEYRLIEVSIN 502
           HL EY+L+E  +N
Sbjct: 186 HLTEYKLVEKWVN 198


>AB244761-1|BAE66603.1|  504|Apis mellifera cystathionine
           beta-synthase protein.
          Length = 504

 Score = 21.0 bits (42), Expect = 7.7
 Identities = 5/13 (38%), Positives = 6/13 (46%)
 Frame = +1

Query: 241 CSNRYV*WWWKQR 279
           C N    WWW  +
Sbjct: 359 CQNEMNKWWWNMK 371


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 116,799
Number of Sequences: 438
Number of extensions: 2137
Number of successful extensions: 6
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 14600229
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -