BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ovS323C09f
(521 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY878356-1|AAW63045.1| 280|Homo sapiens reverse transcriptase-l... 29 7.5
>AY878356-1|AAW63045.1| 280|Homo sapiens reverse transcriptase-like
protein protein.
Length = 280
Score = 29.5 bits (63), Expect = 7.5
Identities = 13/47 (27%), Positives = 21/47 (44%)
Frame = +1
Query: 190 WNRSRRCTCATP*RKL*RAHNILLGPLTGNQHDTCDQSSWIWYASXF 330
WN+ R C T K +A I+L T +++W WY + +
Sbjct: 206 WNQKRACIARTILSKKNKASGIMLPDFKLYHKATVTKTAWCWYQNSY 252
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 58,236,671
Number of Sequences: 237096
Number of extensions: 1002840
Number of successful extensions: 1464
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1442
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1464
length of database: 76,859,062
effective HSP length: 85
effective length of database: 56,705,902
effective search space used: 4990119376
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -