BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ovS320D04f
(521 letters)
Database: fruitfly
53,049 sequences; 24,988,368 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AE013599-852|AAF58947.2| 1290|Drosophila melanogaster CG8799-PA ... 28 8.8
>AE013599-852|AAF58947.2| 1290|Drosophila melanogaster CG8799-PA
protein.
Length = 1290
Score = 27.9 bits (59), Expect = 8.8
Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 3/37 (8%)
Frame = +2
Query: 197 RPSRDMQQTDEK---V*VDVIKVSLWLFIVITFFAKI 298
R ++DM Q DE V VDV++++LWL +I A +
Sbjct: 816 RFTKDMSQVDEVLPVVLVDVMQIALWLAGIIIVIANV 852
Database: fruitfly
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 24,988,368
Number of sequences in database: 53,049
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,119,255
Number of Sequences: 53049
Number of extensions: 363642
Number of successful extensions: 585
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 575
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 585
length of database: 24,988,368
effective HSP length: 80
effective length of database: 20,744,448
effective search space used: 1929233664
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -