BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ovS320B03f
(521 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
07_01_1120 - 10338265-10338624,10338739-10338873,10339411-10340451 31 0.42
>07_01_1120 - 10338265-10338624,10338739-10338873,10339411-10340451
Length = 511
Score = 31.5 bits (68), Expect = 0.42
Identities = 17/60 (28%), Positives = 33/60 (55%)
Frame = +2
Query: 218 NFQ*TSKFIDFSTFFL*SPRNSVGLQNFCFE*HMSYKRFYFIFEKERTIKYDDTAYVTSY 397
N++ I+F+TFF+ RN+ L+N F S YFI +++ ++++ A T++
Sbjct: 424 NYRGLKSQINFATFFI---RNATKLENMIFTGGRSNGNAYFIARQQKLLEFEKRASKTAH 480
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,493,023
Number of Sequences: 37544
Number of extensions: 201613
Number of successful extensions: 287
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 284
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 287
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1142636160
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -