SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS319C05f
         (521 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_05_1344 + 35823588-35824643                                         28   5.2  
09_01_0130 + 1962865-1963032,1963201-1963301,1963613-1963709           27   9.1  

>02_05_1344 + 35823588-35824643
          Length = 351

 Score = 27.9 bits (59), Expect = 5.2
 Identities = 9/13 (69%), Positives = 12/13 (92%)
 Frame = -1

Query: 239 QTTPHPSRPSDDD 201
           +T+PHP+ PSDDD
Sbjct: 158 RTSPHPANPSDDD 170


>09_01_0130 + 1962865-1963032,1963201-1963301,1963613-1963709
          Length = 121

 Score = 27.1 bits (57), Expect = 9.1
 Identities = 17/52 (32%), Positives = 22/52 (42%)
 Frame = +1

Query: 73  GRAQLLFFPVDIDHICFISLQFRTFRIYFCDHSYCPVVGCFGQSSSDGRDGC 228
           GRA +      I H   I+L   TF  +        +VG  G S  +GR GC
Sbjct: 64  GRAAISIDRAIIFHFHHINLVINTFNTFPMTGFGISLVGAVGTSGLNGRVGC 115


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,719,617
Number of Sequences: 37544
Number of extensions: 236896
Number of successful extensions: 515
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 507
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 515
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1142636160
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -