Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS318C01f
         (521 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z46934-12|CAA87044.3|  539|Caenorhabditis elegans Hypothetical p...    29   2.0  

>Z46934-12|CAA87044.3|  539|Caenorhabditis elegans Hypothetical
           protein ZK1320.6 protein.
          Length = 539

 Score = 29.1 bits (62), Expect = 2.0
 Identities = 15/51 (29%), Positives = 22/51 (43%), Gaps = 6/51 (11%)
 Frame = +1

Query: 160 YCPCCDTRTGHRRSDLLHTDNTTRTKRNTLF------CVHCALYDAYLVSY 294
           YC  CD+    R S+  H+ N     R           VHC L+ +Y+V +
Sbjct: 119 YCTVCDSNLCERCSESTHSTNVLSKHRRIPLTEKPPPLVHCRLHSSYVVEF 169


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,389,958
Number of Sequences: 27780
Number of extensions: 196224
Number of successful extensions: 442
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 420
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 441
length of database: 12,740,198
effective HSP length: 77
effective length of database: 10,601,138
effective search space used: 1017709248
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)