SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS318B12f
         (521 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667182-1|ABG75734.1|  445|Apis mellifera GABA-gated chloride c...    23   2.5  
DQ667181-1|ABG75733.1|  445|Apis mellifera GABA-gated chloride c...    23   2.5  
AF094822-1|AAC63381.1|  365|Apis mellifera GABA receptor Rdl sub...    23   2.5  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              22   3.3  
AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic ac...    21   7.7  

>DQ667182-1|ABG75734.1|  445|Apis mellifera GABA-gated chloride
           channel protein.
          Length = 445

 Score = 22.6 bits (46), Expect = 2.5
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +1

Query: 166 KTATTNPGPGGV 201
           KTA  NPGP GV
Sbjct: 326 KTARENPGPPGV 337


>DQ667181-1|ABG75733.1|  445|Apis mellifera GABA-gated chloride
           channel protein.
          Length = 445

 Score = 22.6 bits (46), Expect = 2.5
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +1

Query: 166 KTATTNPGPGGV 201
           KTA  NPGP GV
Sbjct: 326 KTARENPGPPGV 337


>AF094822-1|AAC63381.1|  365|Apis mellifera GABA receptor Rdl
           subunit protein.
          Length = 365

 Score = 22.6 bits (46), Expect = 2.5
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +1

Query: 166 KTATTNPGPGGV 201
           KTA  NPGP GV
Sbjct: 265 KTARENPGPPGV 276


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 22.2 bits (45), Expect = 3.3
 Identities = 9/36 (25%), Positives = 21/36 (58%)
 Frame = -1

Query: 509  PVSSSSNSLNAFMISSLVSFSAIFTDMSSIKSSNDT 402
            P+S+++  +  + +  + S   I+T  + I SS++T
Sbjct: 1106 PLSAANGVITGYKVIVIPSGGGIYTKDTKITSSSET 1141


>AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic
           acetylcholine receptorApisa2 subunit protein.
          Length = 541

 Score = 21.0 bits (42), Expect = 7.7
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = -3

Query: 156 CCDRGCHDLFMNI 118
           CCD    D+F NI
Sbjct: 217 CCDEPYPDIFFNI 229


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 141,751
Number of Sequences: 438
Number of extensions: 2694
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 14600229
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -