Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS315H03f
         (521 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC125270-1|AAI25271.1|  669|Homo sapiens FSHR protein protein.         31   3.2  

>BC125270-1|AAI25271.1|  669|Homo sapiens FSHR protein protein.
          Length = 669

 Score = 30.7 bits (66), Expect = 3.2
 Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 8/71 (11%)
 Frame = -3

Query: 252 PDGFTHL--FLYKICSTTFVKH-PNYLKI-PIEKII----EIGLKKAKMIRFNNRRLKTL 97
           P+ F +L    Y + S T +KH P+  KI  ++K++    + G+++     FN  +L  L
Sbjct: 113 PEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLWLNKNGIQEIHNCAFNGTQLDEL 172

Query: 96  KLGDDGNLERV 64
            L D+ NLE +
Sbjct: 173 NLSDNNNLEEL 183


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 63,625,000
Number of Sequences: 237096
Number of extensions: 1224526
Number of successful extensions: 2386
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2351
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2385
length of database: 76,859,062
effective HSP length: 85
effective length of database: 56,705,902
effective search space used: 4990119376
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)