Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS315D03f
         (521 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK092888-1|BAC03997.1|  218|Homo sapiens protein ( Homo sapiens ...    29   7.5  

>AK092888-1|BAC03997.1|  218|Homo sapiens protein ( Homo sapiens
           cDNA FLJ35569 fis, clone SPLEN2005783. ).
          Length = 218

 Score = 29.5 bits (63), Expect = 7.5
 Identities = 14/41 (34%), Positives = 22/41 (53%)
 Frame = +3

Query: 318 EMQCRKGEPLPLGWAQGPDGKITQDAELAFKTSCLMPLGGG 440
           ++ C K   +   W+  P   +TQ+AE     +CL P+GGG
Sbjct: 148 KLVCAKKTKISQAWSCAPVIPVTQEAEAG---NCLNPVGGG 185


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 71,042,461
Number of Sequences: 237096
Number of extensions: 1543983
Number of successful extensions: 7293
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 7079
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7284
length of database: 76,859,062
effective HSP length: 85
effective length of database: 56,705,902
effective search space used: 4990119376
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)