BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314H10f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 23 2.5 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 22 4.4 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 21 7.7 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 22.6 bits (46), Expect = 2.5 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -2 Query: 490 FPQLEMSSHSRRKPCFVLLLYVLFCISLISAPAAKAF 380 +P + RR+P F + +L CI LI++ A F Sbjct: 200 YPDITYEIRLRRRPMFYVFNLILPCI-LINSVALLVF 235 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.8 bits (44), Expect = 4.4 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 396 GADIKEMQNNTYSSNTKQ 449 GA++KE+ NT+ N Q Sbjct: 402 GANVKELIRNTHCVNNNQ 419 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.0 bits (42), Expect = 7.7 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = -1 Query: 401 STSRKSLLVTSDDDGSNVAVGVKIIDCLPEFNK 303 S S + +L+T+ ++G+N + +CL K Sbjct: 461 SNSNQFILMTTVNEGNNNMAATYMNECLLNIQK 493 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,402 Number of Sequences: 438 Number of extensions: 2943 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -