BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314G09f (486 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC790.02 |pep3|vps18, vps18|ubiquitin-protein ligase E3 |Schiz... 29 0.49 SPBC16H5.02 |pfk1||6-phosphofructokinase |Schizosaccharomyces po... 27 1.5 SPBP8B7.29 |||para-aminobenzoate synthase |Schizosaccharomyces p... 26 2.6 SPBC1706.01 |tea4|wsh3|tip elongation aberrant protein Tea4|Schi... 26 2.6 SPBC32F12.08c |duo1||DASH complex subunit Duo1 |Schizosaccharomy... 26 3.5 SPAC3G9.16c |bet5|SPAC688.15|TRAPP complex subunit Bet5 |Schizos... 25 6.1 SPCC74.06 |mak3|phk2|histidine kinase Mak3 |Schizosaccharomyces ... 25 8.0 >SPCC790.02 |pep3|vps18, vps18|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 900 Score = 28.7 bits (61), Expect = 0.49 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = -2 Query: 338 SANEVYILYFLEFSGNHVLYREIDL 264 S+NE Y++ ++E GNH LY ++DL Sbjct: 659 SSNESYLMNYIEQQGNHPLY-DMDL 682 >SPBC16H5.02 |pfk1||6-phosphofructokinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 942 Score = 27.1 bits (57), Expect = 1.5 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +2 Query: 143 DACVQGLKVYCDETQVAEKLSRRSGFTC 226 D C+ + YCD + + SRR F C Sbjct: 727 DTCLNAVMEYCDTIKQSASASRRRVFVC 754 >SPBP8B7.29 |||para-aminobenzoate synthase |Schizosaccharomyces pombe|chr 2|||Manual Length = 718 Score = 26.2 bits (55), Expect = 2.6 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +3 Query: 402 TKIDNMASYSTYTGKQNF 455 TK+DN++ ++ GKQNF Sbjct: 418 TKLDNLSCLHSFDGKQNF 435 >SPBC1706.01 |tea4|wsh3|tip elongation aberrant protein Tea4|Schizosaccharomyces pombe|chr 2|||Manual Length = 809 Score = 26.2 bits (55), Expect = 2.6 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +3 Query: 372 DKPLVQIMVVTKIDNMASYSTYTGKQNFSKELVP 473 D PL + + V + + AS+S+Y+ N K L P Sbjct: 391 DSPLRRSLSVDAMQSNASFSSYSSTSNTDKSLRP 424 >SPBC32F12.08c |duo1||DASH complex subunit Duo1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 166 Score = 25.8 bits (54), Expect = 3.5 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +1 Query: 343 IKSFESFLKGINLLFKLWL*RKSITWPRTPHTRENKISPKNW 468 IKSFE+ + N L +LW S +T HT +N I +W Sbjct: 33 IKSFETSINNSNRLIQLW----SSVLSQTEHT-QNLILNSDW 69 >SPAC3G9.16c |bet5|SPAC688.15|TRAPP complex subunit Bet5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 155 Score = 25.0 bits (52), Expect = 6.1 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -2 Query: 392 NLNKRFIPFKKLSKLLIHSANEVYILYFLEFSGNHVLYREI 270 NL FI K+ L H ++Y ++EF H LY + Sbjct: 88 NLRLIFITNPKIDSLT-HVLQQIYTTLYVEFVVKHPLYTHV 127 >SPCC74.06 |mak3|phk2|histidine kinase Mak3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 2344 Score = 24.6 bits (51), Expect = 8.0 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Frame = +2 Query: 50 RLIHLIY-LV*TIQYYYREERETHCRADYGDVDACVQGL-KVYCDETQVAEKLSRRSGF 220 +L HLI+ ++ + +ER T C D++AC+ + K V EK R S F Sbjct: 260 KLPHLIFKIIEKMTRKNPDERYTSCSGIVNDLEACLDDIDKGLILNDHVLEKTGRTSLF 318 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,899,697 Number of Sequences: 5004 Number of extensions: 34924 Number of successful extensions: 82 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 188065158 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -