BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314G01f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g04020.1 68417.m00572 plastid-lipid associated protein PAP, p... 29 2.5 At1g24360.1 68414.m03072 3-oxoacyl-[acyl-carrier protein] reduct... 27 5.8 >At4g04020.1 68417.m00572 plastid-lipid associated protein PAP, putative / fibrillin, putative strong similarity to plastid-lipid associated proteins PAP1 GI:14248554, PAP2 GI:14248556 from [Brassica rapa], fibrillin [Brassica napus] GI:4139097; contains Pfam profile PF04755: PAP_fibrillin Length = 318 Score = 28.7 bits (61), Expect = 2.5 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +3 Query: 165 GPSSGSAFKAQFTIRVKSPGRLQAKLENPQHGNFNEQLPDPRELP 299 GP S ++F ++SP R+Q K E G QL D E+P Sbjct: 192 GPFSTTSFSTNAKFEIRSPKRVQIKFEQGVIG--TPQLTDSIEIP 234 >At1g24360.1 68414.m03072 3-oxoacyl-[acyl-carrier protein] reductase, chloroplast / 3-ketoacyl-acyl carrier protein reductase identical to 3-oxoacyl-[acyl-carrier protein] reductase SP:P33207 from [Arabidopsis thaliana] Length = 319 Score = 27.5 bits (58), Expect = 5.8 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 168 PSSGSAFKAQFTIRVKSPGRLQAKLENP 251 P S S KAQ T +SPG + K+E+P Sbjct: 50 PFSTSVVKAQATATEQSPGEVVQKVESP 77 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,756,903 Number of Sequences: 28952 Number of extensions: 223373 Number of successful extensions: 612 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 602 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 612 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -