BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314F07f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0116 + 19901546-19901737,19901825-19901899,19902034-199021... 104 4e-23 04_03_0889 + 20568984-20569037,20569271-20569345,20569981-205700... 102 2e-22 07_03_1427 + 26495072-26495148,26495323-26495468,26495581-264957... 43 1e-04 07_03_1428 + 26498201-26498318,26498422-26498570,26498685-26499080 34 0.060 09_01_0137 + 2063881-2063934,2066218-2066448,2066656-2067249,206... 29 3.0 11_06_0736 - 26784531-26785814 27 6.9 >02_04_0116 + 19901546-19901737,19901825-19901899,19902034-19902115, 19902219-19902298,19903279-19903482,19903625-19903750, 19903872-19903985,19904802-19904918 Length = 329 Score = 104 bits (250), Expect = 4e-23 Identities = 46/87 (52%), Positives = 63/87 (72%), Gaps = 1/87 (1%) Frame = +3 Query: 3 AKDYGVYLEDLGHTLRGLFIIDDKGILRQITMNDLPVGRSVDETLRLVQAFQYT-DNHGE 179 +K +GV + D G LRGLFIID +G+++ T+N+L +GRSVDET+R +QA QY DN E Sbjct: 243 SKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETMRTLQALQYVQDNPDE 302 Query: 180 VCPAGWKPGQDTIIPNPSEKKKYFEKV 260 VCPAGWKPG ++ P+P K+YF + Sbjct: 303 VCPAGWKPGDKSMKPDPKGSKEYFAAI 329 >04_03_0889 + 20568984-20569037,20569271-20569345,20569981-20570088, 20572066-20572179,20572393-20572509 Length = 155 Score = 102 bits (245), Expect = 2e-22 Identities = 44/83 (53%), Positives = 63/83 (75%), Gaps = 1/83 (1%) Frame = +3 Query: 15 GVYLEDLGHTLRGLFIIDDKGILRQITMNDLPVGRSVDETLRLVQAFQYT-DNHGEVCPA 191 GV ++ +G LRGLFIID +G+++ T+N+L +GRSVDETLR +QA QY +N EVCPA Sbjct: 73 GVSIDSVGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETLRTLQALQYVQENPDEVCPA 132 Query: 192 GWKPGQDTIIPNPSEKKKYFEKV 260 GWKPG+ ++ P+P + K+YF + Sbjct: 133 GWKPGEKSMKPDPKDSKEYFASI 155 >07_03_1427 + 26495072-26495148,26495323-26495468,26495581-26495729, 26495829-26496224 Length = 255 Score = 43.2 bits (97), Expect = 1e-04 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = +3 Query: 111 VGRSVDETLRLVQAFQYTDNHGEVCPAGWKPGQDTIIP 224 VGR++DE +R V A Q H P WKPG+ +IP Sbjct: 184 VGRNMDEVVRAVDALQTAAKHAVATPVNWKPGERVVIP 221 >07_03_1428 + 26498201-26498318,26498422-26498570,26498685-26499080 Length = 220 Score = 34.3 bits (75), Expect = 0.060 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 114 GRSVDETLRLVQAFQYTDNHGEVCPAGWKPGQDTIIP 224 GR++ E LR A H P WKPG+ +IP Sbjct: 150 GRNMAEVLRATDALLTAARHRVATPVNWKPGERVVIP 186 >09_01_0137 + 2063881-2063934,2066218-2066448,2066656-2067249, 2067980-2068639,2068910-2069164 Length = 597 Score = 28.7 bits (61), Expect = 3.0 Identities = 12/39 (30%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Frame = -1 Query: 452 LMHYHINGVAHFTASRH---RIMNIAILPSKPLIIINYW 345 ++ Y I G+A T R+ +++IAILP++ ++ + +W Sbjct: 325 IISYDIEGIAECTQIRYFASLLLDIAILPTEIMLTVRHW 363 >11_06_0736 - 26784531-26785814 Length = 427 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +3 Query: 111 VGRSVDETLRLVQAFQYTDNHGEVCPAGW 197 +GR+ E+ R+V A YTD EV P GW Sbjct: 340 LGRAWGESSRVVYA--YTDMSKEVVPVGW 366 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,527,206 Number of Sequences: 37544 Number of extensions: 250896 Number of successful extensions: 510 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 508 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -