BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314F07f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 22 4.4 AF134820-1|AAD40235.1| 166|Apis mellifera putative Ets-family p... 22 4.4 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 21 5.8 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 5.8 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 21 5.8 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -1 Query: 266 FSNLFKIFLLLRRIWYNCVLTRFPAC 189 F+ L +F+L RR+ Y T P C Sbjct: 231 FTCLEVVFVLKRRLGYYLFHTYIPTC 256 >AF134820-1|AAD40235.1| 166|Apis mellifera putative Ets-family protein protein. Length = 166 Score = 21.8 bits (44), Expect = 4.4 Identities = 11/47 (23%), Positives = 23/47 (48%) Frame = -3 Query: 240 SSQKDLV*LCPDQVSSLLGKLHHDYQYIGMLEQVSMFHQLNVLLANH 100 + + DL C ++S + HD +L+ + QLN++ ++H Sbjct: 32 NGKXDLFARCMGGINSRNMDIEHDPGLAAVLQYLIRSGQLNIISSDH 78 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 21.4 bits (43), Expect = 5.8 Identities = 7/18 (38%), Positives = 9/18 (50%) Frame = +1 Query: 280 YYYQNQKGVCIGNYFLYC 333 Y YQ +G+YF C Sbjct: 441 YIYQKMVADVVGDYFFIC 458 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 5.8 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -3 Query: 462 SSELNALSHKWCSTFYGI*APHHEY 388 S N L + S G +PHHEY Sbjct: 505 SGSRNPLLQEHDSVMLGEISPHHEY 529 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.4 bits (43), Expect = 5.8 Identities = 7/18 (38%), Positives = 9/18 (50%) Frame = +1 Query: 280 YYYQNQKGVCIGNYFLYC 333 Y YQ +G+YF C Sbjct: 441 YIYQKMVADVVGDYFFIC 458 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,312 Number of Sequences: 438 Number of extensions: 3283 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -